Glyma19g38854 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g38854): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g38854): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g38854

Feature Type:	gene_model
Chromosome:	Gm19
Start:	45715838
stop:	45717982
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g38854

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G11750	AT	Annotation by Michelle Graham. TAIR10: Dihydroneopterin aldolase \| chr3:3715071-3715904 REVERSE LENGTH=146	SoyBase	E_val: 1.00E-38	ISS
GO:0006760	GO-bp	Annotation by Michelle Graham. GO Biological Process: folic acid-containing compound metabolic process	SoyBase	N/A	ISS
GO:0010304	GO-bp	Annotation by Michelle Graham. GO Biological Process: PSII associated light-harvesting complex II catabolic process	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004150	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dihydroneopterin aldolase activity	SoyBase	N/A	ISS
PTHR20941	Panther	FOLATE SYNTHESIS PROTEINS	JGI		ISS
PTHR20941:SF3	Panther	DIHYDRONEOPTERIN ALDOLASE	JGI		ISS
PF02152	PFAM	Dihydroneopterin aldolase	JGI		ISS
UniRef100_E9NZT1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dihydroneopterin aldolase n=2 Tax=Phaseolus vulgaris RepID=E9NZT1_PHAVU	SoyBase	E_val: 3.00E-61	ISS
UniRef100_I1NAW1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NAW1_SOYBN	SoyBase	E_val: 3.00E-84	ISS

Expression Patterns of Glyma19g38854

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g38854 not represented in the dataset	Glyma19g38854 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g38854

Paralog	Evidence	Comments
Glyma03g36210	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g38854 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g201200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g38854

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g38854

Limit To All Plant Sequences

>Glyma19g38854.1   sequence type=CDS   gene model=Glyma19g38854   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTGATGCACTGACATGGGGAGACAAACTCATGCTATGGGGATTGTCATTCCATGGTTTTCATGGAGCAAAGCCCGAAGAAAGGACGCTGGGCCAGAAGTTCTTCATAGATATAGATGCTTGGATGGATCTCAAAGCAGCTGGCAAATCTGATCACTTATCAGATACCGTTTGTTACACAGAAGAAATATATGATATAGCTAAGGAAGTTCTTGAAGGCTCACCTCACAACCTTCTGGAGTCTCTGGCCCAAAAAATTGCAATTACTATCACAAATCATAAAGAAATATCTGCTGTTCGAGTGAAGGTTGGAAAGCCTCATGTTTACTGCTTAGGCGTTGAGATTCTTAGACGCAGAAGTTTCATATTTACTGCTGCAGAATTTTTATATTTTCACGTTCCACTTGAGACAAAAGCAACGAAATTCAAAGCCAATAACTCTCGTCTTGATGTTGACAAAGATTACCAATGCATAATTGTATCTTCGATTATGTTAAAGAGTTCAAAGGTATGCCTTTTTAGTTCAATTAAACCAGAAGCTGTGATGAACCCGCAATTATAA

Predicted protein sequences of Glyma19g38854

Limit To All Plant Sequences

>Glyma19g38854.1   sequence type=predicted peptide   gene model=Glyma19g38854   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESDALTWGDKLMLWGLSFHGFHGAKPEERTLGQKFFIDIDAWMDLKAAGKSDHLSDTVCYTEEIYDIAKEVLEGSPHNLLESLAQKIAITITNHKEISAVRVKVGKPHVYCLGVEILRRRSFIFTAAEFLYFHVPLETKATKFKANNSRLDVDKDYQCIIVSSIMLKSSKVCLFSSIKPEAVMNPQL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain