SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g38600

Feature Type:gene_model
Chromosome:Gm19
Start:45472343
stop:45473543
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g38600
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11660AT Annotation by Michelle Graham. TAIR10: NDR1/HIN1-like 1 | chr3:3679031-3679660 REVERSE LENGTH=209 SoyBaseE_val: 1.00E-94ISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_E4MXF7UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-27-A10 n=1 Tax=Eutrema halophilum RepID=E4MXF7_THEHA SoyBaseE_val: 1.00E-87ISS
UniRef100_I1NAT8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAT8_SOYBN SoyBaseE_val: 8.00E-153ISS

Expression Patterns of Glyma19g38600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g38600
ParalogEvidenceComments
Glyma03g36000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g38600 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g198900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g38600
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g38600
>Glyma19g38600.1   sequence type=CDS   gene model=Glyma19g38600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGGTTAAGGAGTGCCACCACCACCACAAGGGAAAGAAGCACAAGCTCTGGAGACGCATCTTCTGGGGAATAGTGATCTTCGCCTTCATCGTGTTACTGACAGTTCTTATAATCTGGGCAATCCTAAAGCCTTCAAAACCAACCTTCATCCTCCAAGACGTCACCGTTTACGGCTTCAATGCCACCATCCCCAACTTCCTCACCTCAAGTTTTCAGGTCACGCTTTCCTCGCGCAACCCCAACGACAAAATCGGAATCTACTACGACCGTCTCAACACCTACGTAACTTACCGGAACCAGCAGGTCACGTACCGAACCTCAATCCCACCCTCGTACCAAGGTCACAAGGAAGAGGATGTGTGGTCCCCGTTTGTCTACGGCACTAATGTCCCCGTCGCACCCTACAACTTCGTTGGCCTCAGTCAAGACCAGACCAACGGCAACGTCCTCGTCCTCGTTAAGATTGACGGTAAGGTACGATGGAAAGTTGGTTCCTTCGTCTCTGCTCACTACAACCTCAATGTAAGGTGCCCTGCTTTCATAACCTTTGGCCCCCAAAGCAACGGGATTGCCCTTGGCAATAACGCCGTTAAGTATCAATTGGTTCAACGCTGCACCGTCGGGGTTTGA
Predicted protein sequences of Glyma19g38600
>Glyma19g38600.1   sequence type=predicted peptide   gene model=Glyma19g38600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSVKECHHHHKGKKHKLWRRIFWGIVIFAFIVLLTVLIIWAILKPSKPTFILQDVTVYGFNATIPNFLTSSFQVTLSSRNPNDKIGIYYDRLNTYVTYRNQQVTYRTSIPPSYQGHKEEDVWSPFVYGTNVPVAPYNFVGLSQDQTNGNVLVLVKIDGKVRWKVGSFVSAHYNLNVRCPAFITFGPQSNGIALGNNAVKYQLVQRCTVGV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo