Glyma19g38540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g38540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g38540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g38540

Feature Type:	gene_model
Chromosome:	Gm19
Start:	45433282
stop:	45438553
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g38540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G06300	AT	Annotation by Michelle Graham. TAIR10: Putative lysine decarboxylase family protein \| chr5:1922042-1925278 REVERSE LENGTH=217	SoyBase	E_val: 2.00E-128	ISS
GO:0006826	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron ion transport	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009741	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus	SoyBase	N/A	ISS
GO:0010106	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0016831	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carboxy-lyase activity	SoyBase	N/A	ISS
PF03641	PFAM	Possible lysine decarboxylase	JGI		ISS
UniRef100_B9SVY2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Carboxy-lyase, putative n=1 Tax=Ricinus communis RepID=B9SVY2_RICCO	SoyBase	E_val: 2.00E-127	ISS
UniRef100_UPI000233E2F9	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E2F9 related cluster n=1 Tax=unknown RepID=UPI000233E2F9	SoyBase	E_val: 6.00E-153	ISS

Expression Patterns of Glyma19g38540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g38540 not represented in the dataset	Glyma19g38540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g38540

Paralog	Evidence	Comments
Glyma03g35880	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g38540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g198400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g38540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g38540

Limit To All Plant Sequences

>Glyma19g38540.1   sequence type=CDS   gene model=Glyma19g38540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAGACCAATTCCAGATTCAAGAGGATTTGCGTCTTCTGTGGGAGCAGTTCAGGGAAGAAACCTACATATCAAGAAGCTGCTGTTCAACTTGGCAGGGAGCTGGTGGAAAGACGGATTGATTTGGTCTATGGAGGTGGTAGCGTGGGGCTGATGGGCCTCGTTTCTCAGGCAGTTCATGATGGTGGGCGCCATGTTCTAGGGGTTATCCCAACAAGTCTTATGCCAAGAGAGATAACAGGTGATCCTATTGGGGAAGTGAGAGCCGTATCTAGTATGCACCAAAGGAAAGCCGAGATGGCCCGTCAAGCCGATGCCTTTATTGCCCTCCCTGGAGGATATGGAACCCTTGAAGAATTGCTGGAAGTCATTACATGGGCGCAGCTTGGGATCCACAGCAAACCCGTGGGCCTGTTGAATGTGGATGGATTTTACAATTCCTTGTTGTCGTTCATTGACAAAGCCGTTGATGAAGGCTTTATATCCCCTACGGCACGTCGCATTATCGTGTCAGCACCCACAGCCAAACAATTGATGCTAGAGCTAGAGGAACATGTTCCTGAGCAAGATGAGTTTGCGTCCAAGTTGGTGTGGGAAGAAAGACTTTACGTGACTGAATCAGAAGTTGCCATGTGA

Predicted protein sequences of Glyma19g38540

Limit To All Plant Sequences

>Glyma19g38540.1   sequence type=predicted peptide   gene model=Glyma19g38540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEETNSRFKRICVFCGSSSGKKPTYQEAAVQLGRELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHVLGVIPTSLMPREITGDPIGEVRAVSSMHQRKAEMARQADAFIALPGGYGTLEELLEVITWAQLGIHSKPVGLLNVDGFYNSLLSFIDKAVDEGFISPTARRIIVSAPTAKQLMLELEEHVPEQDEFASKLVWEERLYVTESEVAM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain