SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g38510

Feature Type:gene_model
Chromosome:Gm19
Start:45415251
stop:45415718
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g38510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52520AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G06280.3); Has 24 Blast hits to 24 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 24; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:19473483-19473884 FORWARD LENGTH=133 SoyBaseE_val: 2.00E-16ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1NAS9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAS9_SOYBN SoyBaseE_val: 2.00E-106ISS

Expression Patterns of Glyma19g38510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g38510
ParalogEvidenceComments
Glyma03g35850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g38510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g198100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g38510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g38510
>Glyma19g38510.1   sequence type=CDS   gene model=Glyma19g38510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAGACAGAGTCCACCACAACCCCCGCGCCGTCAGAGTCGCCGCCCCTCCGCCGCCACAACTCCATCGCTGCCCCATCGGTGCCCAAACTCTTCCTCCCCGCCACGCCGCCGCAGCGCACAACAAGCTTCGAACTTGTATCCCTTAAATCCCCCTTTTCCGCCTCCTACACTTCCCTCCGAGACGTGCTTCCTTCTCCCTACGCCGCCGTGAACTCCCCCACCGCCTCCGCGTACTCCGGCCAAGAGATTTCCATCCGCAACCGCCTCGTCAAGCAGGCCGCCTGGGCCTACCTTCAGCCCATGTCCGCCTCCCCCGGCGGCGCCTCCACACCCCACTTCCTCCGCCGCCTCTCCGCCACCTGCCTCGGCTTCTTCTACCACCACTTCATTCCCGTCGTTTCCCGGGTTTTCAGTCGAATGCTCCACGCTCTCAGGGTTCACGTGTGCAGATGCTACTCTTGA
Predicted protein sequences of Glyma19g38510
>Glyma19g38510.1   sequence type=predicted peptide   gene model=Glyma19g38510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAETESTTTPAPSESPPLRRHNSIAAPSVPKLFLPATPPQRTTSFELVSLKSPFSASYTSLRDVLPSPYAAVNSPTASAYSGQEISIRNRLVKQAAWAYLQPMSASPGGASTPHFLRRLSATCLGFFYHHFIPVVSRVFSRMLHALRVHVCRCYS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo