SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g38331

Feature Type:gene_model
Chromosome:Gm19
Start:45251572
stop:45253628
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g38331
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11340AT Annotation by Michelle Graham. TAIR10: S-locus lectin protein kinase family protein | chr1:3814116-3817420 REVERSE LENGTH=901 SoyBaseE_val: 2.00E-35ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0048544GO-bp Annotation by Michelle Graham. GO Biological Process: recognition of pollen SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF430Panther SUBFAMILY NOT NAMED JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_I1MIK3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MIK3_SOYBN SoyBaseE_val: 2.00E-49ISS
UniRef100_Q1S5I9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine-rich receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=Q1S5I9_MEDTR SoyBaseE_val: 6.00E-45ISS

Expression Patterns of Glyma19g38331
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g38331 not represented in the dataset
Glyma19g38331 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g38331 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g38331
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g38331
>Glyma19g38331.1   sequence type=CDS   gene model=Glyma19g38331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCCATTAATCACAATTCTACAGAGTACCGATAACTTTTCAGAAGCATCTAAATTAGGGGAACGTGGATTTGGCCCCGTTTACAAGGGAATTCTACCAGATCGAAGGCAAATTGCAGTCAAAAGGCTCTCAAAAGTTTTTGGTCAAGGCTCAGCGGAGTTCAATAATGAAGTAACGTTTATAGCTAAACTGCAACATCGCAACCTTGTAAGGCTTTTGGCATGTTGCTTGGAGGAAAATGAAAAGATACTTGTGTATGAGTATTTGACAGACATGAGTCTTGACTTTCACCTGCTTCATAGGTTAAAATACACACATTTTGATTGTTCAATCATAACGTGA
Predicted protein sequences of Glyma19g38331
>Glyma19g38331.1   sequence type=predicted peptide   gene model=Glyma19g38331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMPLITILQSTDNFSEASKLGERGFGPVYKGILPDRRQIAVKRLSKVFGQGSAEFNNEVTFIAKLQHRNLVRLLACCLEENEKILVYEYLTDMSLDFHLLHRLKYTHFDCSIIT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo