Report for Sequence Feature Glyma19g38320
Feature Type: gene_model
Chromosome: Gm19
Start: 45248980
stop: 45250888
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g38320
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G06240 AT
Annotation by Michelle Graham. TAIR10: embryo defective 2735 | chr5:1888380-1889512 FORWARD LENGTH=162
SoyBase E_val: 1.00E-73 ISS
GO:0009793 GO-bp
Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_D7LZ53 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: EMB2735 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LZ53_ARALL
SoyBase E_val: 6.00E-72 ISS
UniRef100_I1NAR3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAR3_SOYBN
SoyBase E_val: 4.00E-115 ISS
Expression Patterns of Glyma19g38320
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g38320
Paralog Evidence Comments
Glyma03g35690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g38320 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g196500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g38320
Coding sequences of Glyma19g38320
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g38320.1 sequence type=CDS gene model=Glyma19g38320 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAAGTGAGGGTTGTTTGCAGGAAAATTTACGACTATATACGCTATGATCTCAAAGAAATCGCTTTCCCCTCTTCTTTGCCAGACCCTCCTCACATCAAAAAGCGTCGCAAATTGACCTGGGACCAGCGTATCTGGGTTTTGAAGAGAGCTGCCCGGCTTTATGCTGCAAGCTGGGTTCGTGACATTGGTCCTGACCTTCGGCCTGATGATTATAAGAAGGATGGTGACATGACTGATGAAACAAATGGTGAAAAGAAAACAACTATAGGAAAAGAACCCTCAACACTGGAGGACCTTGCTGTAGCTGCAAGAGGGGGAATGGAGACTCTCAGACCAGCTTTGCAGCGTGTGTACATGACCAGAGCATCTGCATACAGAGATGCTCTTAAAAGTTTCATAGAAGGGTACCAAGAGGGTGTTCAGCAAGTAATGGAGAAGAAGGAAGATTCCAAACCTCAAGAAGATGCTGATTTACCCAAAAAATCAACTTGA
Predicted protein sequences of Glyma19g38320
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g38320.1 sequence type=predicted peptide gene model=Glyma19g38320 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKVRVVCRKIYDYIRYDLKEIAFPSSLPDPPHIKKRRKLTWDQRIWVLKRAARLYAASWVRDIGPDLRPDDYKKDGDMTDETNGEKKTTIGKEPSTLEDLAVAARGGMETLRPALQRVYMTRASAYRDALKSFIEGYQEGVQQVMEKKEDSKPQEDADLPKKST*