Glyma19g38220 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g38220

Feature Type:	gene_model
Chromosome:	Gm19
Start:	45189668
stop:	45192786
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g38220

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G11530	AT	Annotation by Michelle Graham. TAIR10: Vacuolar protein sorting 55 (VPS55) family protein \| chr3:3628801-3629885 REVERSE LENGTH=113	SoyBase	E_val: 4.00E-71	ISS
GO:0006661	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
KOG2174	KOG	Leptin receptor gene-related protein	JGI		ISS
PTHR12050	Panther	LEPTIN RECEPTOR-RELATED	JGI		ISS
PF04133	PFAM	Vacuolar protein sorting 55	JGI		ISS
UniRef100_I1NAQ6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NAQ6_SOYBN	SoyBase	E_val: 1.00E-75	ISS
UniRef100_Q93Z28	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT3g11530/F24K9_21 n=1 Tax=Arabidopsis thaliana RepID=Q93Z28_ARATH	SoyBase	E_val: 8.00E-69	ISS

Expression Patterns of Glyma19g38220

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g38220

Paralog	Evidence	Comments
Glyma03g35591	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g38220 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g195900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g38220

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g38220

Limit To All Plant Sequences

>Glyma19g38220.1   sequence type=CDS   gene model=Glyma19g38220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTCAGCTAGCATTTTGCTTCAGATTCTGGCATGTGCAATATATAACAATTGGTGGCCAATGTTATCAGCTCTGATGTATGTGCTGGTTCCTATGCCTTGCTTATTCTTTGGAGGTGGATCCACTCAATTTCTAATGACCCGTGATGGTGGTGGTTGGATAGATGCTGCAAAATTTTTGACTGGAGCATCAGCTGTTGGGAGCTTAGCCATTCCTATCATTCTCAAGCACGCTCATATGATTGAGACAGGCGCGATGCTCATTGAGCTTGTATCATTCTTCATATTTATATGTACTGTTTTATGTTTCCACCAAGCCAGCCTTGATGATGATTGGTAA

Predicted protein sequences of Glyma19g38220

Limit To All Plant Sequences

>Glyma19g38220.1   sequence type=predicted peptide   gene model=Glyma19g38220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSASILLQILACAIYNNWWPMLSALMYVLVPMPCLFFGGGSTQFLMTRDGGGWIDAAKFLTGASAVGSLAIPIILKHAHMIETGAMLIELVSFFIFICTVLCFHQASLDDDW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain