Glyma19g38020 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g38020

Feature Type:	gene_model
Chromosome:	Gm19
Start:	45053062
stop:	45053938
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g38020

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G10120	AT	Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G03890.1); Has 57 Blast hits to 57 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 57; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:3130155-3130676 FORWARD LENGTH=173	SoyBase	E_val: 1.00E-33	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1NAN8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAN8_SOYBN	SoyBase	E_val: 2.00E-106	ISS
UniRef100_Q9LZC0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Emb\|CAB85509.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LZC0_ARATH	SoyBase	E_val: 5.00E-30	ISS

Expression Patterns of Glyma19g38020

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g38020

Paralog	Evidence	Comments
Glyma03g35400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g38020 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g38020

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g38020

Limit To All Plant Sequences

>Glyma19g38020.1   sequence type=CDS   gene model=Glyma19g38020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAACTGCTTGGTGCTGCAAGAGAACGTTGTGAAGATCGTGAAAACCGATGGGAAAGTTCTTGAATACAAAACACCCATCAAAGTGGAAGAGGTTCTGATACAATTTTCTGGCCATGCAGTGTCTGAATCACTCACAGTGCTGCGGCATCTTGAGCCACACACAAAGTTGCTTAGAGGGCAGTTATATTACCTAGTGCCTCTGCCACCATCACCAAAAACCAACAAGAAGGTGAGGTTTGCGGAACCAGAAGTCCAAGATGTACATAAAAGTAACGTGGTTAGGATTAAGGTGGTTATTAGTAAGCAACAGCTGCAGAACATGCTGCAGAATGGAGGGTTTTCGGTTAGTAAGATGTTGTCTCTAGTTCATGAGGAGAAGGGTACTGAAGATTTGTCTCAAAAGAGTGAGGATGTTTCTCAAGGGTGGAAACCAGCGTTGGAAAGCATACCTGAAGTAAAGTAG

Predicted protein sequences of Glyma19g38020

Limit To All Plant Sequences

>Glyma19g38020.1   sequence type=predicted peptide   gene model=Glyma19g38020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNCLVLQENVVKIVKTDGKVLEYKTPIKVEEVLIQFSGHAVSESLTVLRHLEPHTKLLRGQLYYLVPLPPSPKTNKKVRFAEPEVQDVHKSNVVRIKVVISKQQLQNMLQNGGFSVSKMLSLVHEEKGTEDLSQKSEDVSQGWKPALESIPEVK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain