SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g37961

Feature Type:gene_model
Chromosome:Gm19
Start:45031366
stop:45034041
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g37961
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52730AT Annotation by Michelle Graham. TAIR10: ubiquinol-cytochrome C reductase UQCRX/QCR9-like family protein | chr3:19543146-19544167 REVERSE LENGTH=72 SoyBaseE_val: 1.00E-33ISS
GO:0006122GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial electron transport, ubiquinol to cytochrome c SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005740GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial envelope SoyBaseN/AISS
GO:0005750GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex III SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008121GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquinol-cytochrome-c reductase activity SoyBaseN/AISS
KOG3494 KOG Ubiquinol cytochrome c oxidoreductase, subunit QCR9 JGI ISS
PTHR12980Panther UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX, SUBUNIT X JGI ISS
PF05365PFAM Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like JGI ISS
UniRef100_G7L638UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquinol-cytochrome c reductase complex protein n=1 Tax=Medicago truncatula RepID=G7L638_MEDTR SoyBaseE_val: 7.00E-35ISS
UniRef100_I1NAN2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAN2_SOYBN SoyBaseE_val: 2.00E-43ISS

Expression Patterns of Glyma19g37961
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g37961 not represented in the dataset
Glyma19g37961 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g37961
ParalogEvidenceComments
Glyma03g35340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g37961 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g37961
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g37961
>Glyma19g37961.1   sequence type=CDS   gene model=Glyma19g37961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCTGTTTCTCGAAGAAGAGGTGGAGGCATTTTCGAAAGCCTCTACAAGGTCGTTATGCGTCGCAACTCTGTCTACGTTACCTTCGTCATCGCTGGCGCCTTCCTCGGAGAACGGGCTGTAGATTATGGAGTCCACAAGCTCTGGGAGGCTAATAATGTTGGGAAACGATATGAAGACATTCCTGTGCTAGGGCAAAGGCAGTCAGAATAG
Predicted protein sequences of Glyma19g37961
>Glyma19g37961.1   sequence type=predicted peptide   gene model=Glyma19g37961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAVSRRRGGGIFESLYKVVMRRNSVYVTFVIAGAFLGERAVDYGVHKLWEANNVGKRYEDIPVLGQRQSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo