Report for Sequence Feature Glyma19g37900
Feature Type: gene_model
Chromosome: Gm19
Start: 44992180
stop: 44996985
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g37900
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G36290 AT
Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr2:15208867-15210768 REVERSE LENGTH=364
SoyBase E_val: 1.00E-119 ISS
GO:0000041 GO-bp
Annotation by Michelle Graham. GO Biological Process: transition metal ion transport
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009611 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to wounding
SoyBase N/A ISS
GO:0009805 GO-bp
Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process
SoyBase N/A ISS
GO:0009963 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0016787 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrolase activity
SoyBase N/A ISS
KOG1454
KOG
Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily)
JGI ISS
PTHR10992 Panther
ALPHA/BETA HYDROLASE RELATED
JGI ISS
PTHR10992:SF198 Panther
ESTERASE/LIPASE/THIOESTERASE FAMILY PROTEIN
JGI ISS
UniRef100_E0Y457 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Esterase/lipase superfamily protein n=1 Tax=Prunus armeniaca RepID=E0Y457_PRUAR
SoyBase E_val: 5.00E-136 ISS
UniRef100_I1NAM5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NAM5_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma19g37900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g37900
Paralog Evidence Comments
Glyma03g35260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g37900 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g194400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g37900
Coding sequences of Glyma19g37900
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g37900.1 sequence type=CDS gene model=Glyma19g37900 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
AGAGGGAGAAATGGAGAGTGGAGTGAACAGAAGAAAAAAATTCTGCAGCATCAGCCCGTGCTCATACCAGGAACCAAAATAAAAGCACTTCAATTCATCTCCCTTCGGTTTGTTACCCAAGACAGAATTTTTGGAACAGTGCTGGCAGTGTTGTTCATTGGGTTTGTAGCATGGGGTTATCAAGCTATTCAACCTCCTGCTTCAAAGATATGTGGATCTCCTAATGGGTCCACTATAACAGCACCCAGAATCAAACTAAGAGATGGAAGGAATTTAGCATACAAAGAGCATGGTGTCCCAAAAGATGTAGCCAAGCATAAAATCATCTTTGTCCATGGTTTTGATGCTTGCAGGCATGATGCCTATGTTTCCAAAACACTATCACCTGATGTTGCTGAGAAATTAGGGGTCTACATTGTATCTTTTGATAGACCCGGGTATGGGGAAAGTGATCCTGATCCAATTCAAACACTGAAGAGCCTGGCATTAGATATAGAAGAACTTGCTGATAAATTGGGATTAGGGCCAAATTCTACGTGCCTTATGTACATCCCTCACAGACTGGCAAGTGCAGTGCTCATAGCCCCAGTTCTCAACTACTGGTGGGCTGGTCTTCCTGCAAACTTAACTACTGAAGTTTTCTACCAACAAAAACTTCAAGACCAGTGGACAGTTTGTGTTGCTCACTACATACCATGGCTAACTTACTGTTGGAACACTCAAAGATGGTTCCCAGCTTCTAGTTTAATTGCTGACAGTATAGATCTTCTATCCCTTCAGGACAAAGAACTTTTGCCTAAGAGTATCAATTTAGGAGTAGATGCCATACCAGAAACACATAGCATCCGTGCAGAAGCACCATGGAATATGTATGGAGTGTCACTTAGCTCAGGTTCGGTCCATATTTGGCAAGGAGATGAAGATTTGATAGTGCCTGCTAAAGTGCAACGATACATTGCACAAAAGCTTCCGTGGATTCAGTATCATGAGCTTCAAGGTGCTGACCACTTGTTCCCTCATGTTGATGGTATGAGTGATACTATCATTATGTCACTTTTAAGTGGGAATTAA
Predicted protein sequences of Glyma19g37900
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g37900.1 sequence type=predicted peptide gene model=Glyma19g37900 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
RGRNGEWSEQKKKILQHQPVLIPGTKIKALQFISLRFVTQDRIFGTVLAVLFIGFVAWGYQAIQPPASKICGSPNGSTITAPRIKLRDGRNLAYKEHGVPKDVAKHKIIFVHGFDACRHDAYVSKTLSPDVAEKLGVYIVSFDRPGYGESDPDPIQTLKSLALDIEELADKLGLGPNSTCLMYIPHRLASAVLIAPVLNYWWAGLPANLTTEVFYQQKLQDQWTVCVAHYIPWLTYCWNTQRWFPASSLIADSIDLLSLQDKELLPKSINLGVDAIPETHSIRAEAPWNMYGVSLSSGSVHIWQGDEDLIVPAKVQRYIAQKLPWIQYHELQGADHLFPHVDGMSDTIIMSLLSGN*