SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g37890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g37890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g37890

Feature Type:gene_model
Chromosome:Gm19
Start:44979743
stop:44981657
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03840AT Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein | chr5:1024760-1025796 REVERSE LENGTH=177 SoyBaseE_val: 1.00E-97ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0090344GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of cell aging SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031982GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vesicle SoyBaseN/AISS
GO:0003712GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription cofactor activity SoyBaseN/AISS
GO:0008429GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding SoyBaseN/AISS
KOG3346 KOG Phosphatidylethanolamine binding protein JGI ISS
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI ISS
PF01161PFAM Phosphatidylethanolamine-binding protein JGI ISS
UniRef100_D5ID20UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dt1 n=3 Tax=Glycine RepID=D5ID20_SOYBN SoyBaseE_val: 4.00E-125ISS
UniRef100_D5ID20UniRef Annotation by Michelle Graham. Best UniRef hit: Dt1 n=3 Tax=Glycine RepID=D5ID20_SOYBN SoyBaseE_val: 4.00E-125ISS

LocusGene SymbolProtein Name
Dt1 Determinancy gene 1
TFL1 Terminal Flower 1

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g37890 not represented in the dataset

Glyma19g37890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g35250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g194300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g37890.1   sequence type=CDS   gene model=Glyma19g37890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAAAATGCCTTTAGAGCCTCTAATAGTGGGGAGAGTCATAGGAGAAGTTCTTGATTCTTTCACCACAAGCACAAAAATGACTGTGAGTTACAACAAGAAGCAAGTTTACAATGGCCATGAGCTCTTCCCTTCCACTGTCAACACCAAGCCCAAGGTTGAGATTGAGGGTGGTGATATGAGGTCCTTCTTTACACTGATCATGACTGACCCTGATGTTCCTGGCCCTAGTGACCCTTATCTGAGAGAGCACTTGCACTGGATAGTGACAGATATTCCAGGCACAACAGATGCCACATTTGGGAAAGAGTTGGTGAGCTATGAGGTCCCAAAGCCTAATATTGGAATCCATAGGTTTGTGTTTGTCCTGTTCAAGCAAAAGCGTAGACAGTGTGTTACTCCACCCACTTCAAGGGACCACTTCAACACACGCAAATTCGCAGCAGAGAACGACCTTGGCCTCCCTGTGGCTGCTGTCTACTTCAATGCACAGAGGGAAACGGCTGCAAGAAGACGCTAG

>Glyma19g37890.1   sequence type=predicted peptide   gene model=Glyma19g37890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYNKKQVYNGHELFPSTVNTKPKVEIEGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVLFKQKRRQCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo