SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g37870

Feature Type:gene_model
Chromosome:Gm19
Start:44959300
stop:44961265
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g37870
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52770AT Annotation by Michelle Graham. TAIR10: protein binding | chr3:19557891-19558094 REVERSE LENGTH=67 SoyBaseE_val: 5.00E-19ISS
GO:0006914GO-bp Annotation by Michelle Graham. GO Biological Process: autophagy SoyBaseN/AISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0009943GO-bp Annotation by Michelle Graham. GO Biological Process: adaxial/abaxial axis specification SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0010305GO-bp Annotation by Michelle Graham. GO Biological Process: leaf vascular tissue pattern formation SoyBaseN/AISS
GO:0010358GO-bp Annotation by Michelle Graham. GO Biological Process: leaf shaping SoyBaseN/AISS
GO:0043433GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_I1NAM2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NAM2_SOYBN SoyBaseE_val: 5.00E-38ISS
UniRef100_Q9LXI8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein little zipper 3 n=1 Tax=Arabidopsis thaliana RepID=Q9LXI8_ARATH SoyBaseE_val: 2.00E-16ISS

Expression Patterns of Glyma19g37870
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g37870
ParalogEvidenceComments
Glyma03g35210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g37870 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g194100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g37870
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g37870
>Glyma19g37870.2   sequence type=CDS   gene model=Glyma19g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGGCTGAACTCAGAGTTGTACTACCAGAACTGTCACATAATGAAAGAGAATGAAAGGCTGAGGAAGAAAGCTCAGCTTCTTAATCAAGAGAATCAACAACTTCTGTCTGAACTCAAAAAGAAGCTCTCCAAGGGAAATGCAAAAACCAATGCTGCTCCAAACACCATTCATGACCTGAACCTTGGCTCAAGTACTAGTCAAAGTCCTTCTGGTTCCAGCAATTAA
Predicted protein sequences of Glyma19g37870
>Glyma19g37870.2   sequence type=predicted peptide   gene model=Glyma19g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MERLNSELYYQNCHIMKENERLRKKAQLLNQENQQLLSELKKKLSKGNAKTNAAPNTIHDLNLGSSTSQSPSGSSN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo