SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g37840

Feature Type:gene_model
Chromosome:Gm19
Start:44938084
stop:44939959
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g37840
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36320AT Annotation by Michelle Graham. TAIR10: A20/AN1-like zinc finger family protein | chr2:15229388-15229873 FORWARD LENGTH=161 SoyBaseE_val: 1.00E-62ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG3173 KOG Predicted Zn-finger protein JGI ISS
PTHR10634Panther PRK1-ASSOCIATED ZINC FINGER PROTEIN JGI ISS
PF01428PFAM AN1-like Zinc finger JGI ISS
PF01754PFAM A20-like zinc finger JGI ISS
UniRef100_B3IX31UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor C2H2 n=1 Tax=Lotus japonicus RepID=B3IX31_LOTJA SoyBaseE_val: 2.00E-69ISS
UniRef100_I1NAL9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAL9_SOYBN SoyBaseE_val: 1.00E-115ISS

Expression Patterns of Glyma19g37840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g37840
ParalogEvidenceComments
Glyma03g35180 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g37840 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g193800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g37840
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g37840
>Glyma19g37840.1   sequence type=CDS   gene model=Glyma19g37840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGAAGAACACCGATGCCAAGCTCCCGAAGGTCACAGACTCTGCTCCAACAACTGCGGTTTCTTTGGTAGCCCCGCCACCATGAATCTCTGTTCCAAATGCTACAGAGACATCCGTTTGAAGGAAGAAGAACAAGCCAAAACCAAATCCACAATCGAAACCGCTCTTTCAGGATCTTCCTCCGCCACCGTCACCGCAACCGCCGTCGTTGCCTCCTCCGTGGAATCCCCTTCGGCGCCGGTTGAATCCCTCCCTCAACCACCGGTGCTGATTTCGCCGGATATAGCCGCACCGGTTCAGGCGAACCGGTGCGGCGCGTGTAGGAAGCGCGTGGGGTTGACAGGGTTCAAGTGCAGGTGCGGAACAACGTTTTGTGGGAGCCACAGGTACCCCGAGAAACACGCGTGTGGCTTCGATTTCAAGGCGGTGGGGAGAGAGGAGATAGCACGGGCGAATCCCGTGATCAAAGGCGAGAAGCTACGGAGGATTTAA
Predicted protein sequences of Glyma19g37840
>Glyma19g37840.1   sequence type=predicted peptide   gene model=Glyma19g37840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEEHRCQAPEGHRLCSNNCGFFGSPATMNLCSKCYRDIRLKEEEQAKTKSTIETALSGSSSATVTATAVVASSVESPSAPVESLPQPPVLISPDIAAPVQANRCGACRKRVGLTGFKCRCGTTFCGSHRYPEKHACGFDFKAVGREEIARANPVIKGEKLRRI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo