Glyma19g37540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g37540

Feature Type:	gene_model
Chromosome:	Gm19
Start:	44648157
stop:	44652724
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g37540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G03740	AT	Annotation by Michelle Graham. TAIR10: histone deacetylase 2C \| chr5:981994-983961 FORWARD LENGTH=294	SoyBase	E_val: 8.00E-58	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0004407	GO-mf	Annotation by Michelle Graham. GO Molecular Function: histone deacetylase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
UniRef100_B9MTN7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone deacetylase n=1 Tax=Populus trichocarpa RepID=B9MTN7_POPTR	SoyBase	E_val: 3.00E-68	ISS
UniRef100_I1NAI9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAI9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g37540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g37540

Paralog	Evidence	Comments
Glyma03g34850	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g37540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g191000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g37540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g37540

Limit To All Plant Sequences

>Glyma19g37540.1   sequence type=CDS   gene model=Glyma19g37540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTTTGGGGTGTTGAGGTGAAAAATGGAGAATCTCTCAAGGTTGATCCAGGAGATGACAAGATTATCCACCTTTCAAATGCATGCATGGGGGATGTCACTAAGGATATAGGAGGTGGACCAGTAGCCCTGTATGTGAAGTTTGGTAACCAGAAGTTTGTACTTGGAACACTTTCTTCTGATAAATTTCCTCAGATATCTTATGATTTGGTATTTGAGAAGGAATTTGAGCTATCCCATAACTGGAAATATGGAAGTGTCTTCTTTACTGGATTTAAAGCTCAACCTCAGTCGGAGTCTGATGATGATGAAGATTCTGATGATATTGATGAAGATATTCCAGTTAGTGCAGTCAATGGTAAACCCGAGGTTGGCGTCAAACCTGATGCAAATGAAGCTAAACAGAAGAAGATAGCAGATCCAAGAAAGAGGGATGCAAATGGTGAAGATGACGATTCATCCGAATCTGATTCTGATGATGATTCAAGTGAAGATAAGCCCACAGCGAATGGCGACATAGAAAGTAGTGAAGGTGATGATGATAGCGATGATGATGAGGAGGAGGAGGGGGATGATGAATCTGATGAGGAGACAGCCAAGAAGATTGAAGCAAGCAATAAGAGGGGTATTGAGTCTTCTAAGAAAACACCTGTTCCTGTGAAGAAGACAAAGTTTGTTACTCCTCAAAAGACTGATAGCAAGAATGTTGTCCATGCTGCAACTCCTCACCCTTCTAAGCAGGCTGGTAAAGCAACTGCAAATAACAAGCTGCAGTCTCCGAAGTCAGGTGGAGATTACAGCTGCAAGCCTTGCAACAGGTTATTTAAGACAGAAGATGCCTTAAGTTCTCATAACAAGGCCAAGCACAGTGCTAAGTGA

Predicted protein sequences of Glyma19g37540

Limit To All Plant Sequences

>Glyma19g37540.1   sequence type=predicted peptide   gene model=Glyma19g37540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFWGVEVKNGESLKVDPGDDKIIHLSNACMGDVTKDIGGGPVALYVKFGNQKFVLGTLSSDKFPQISYDLVFEKEFELSHNWKYGSVFFTGFKAQPQSESDDDEDSDDIDEDIPVSAVNGKPEVGVKPDANEAKQKKIADPRKRDANGEDDDSSESDSDDDSSEDKPTANGDIESSEGDDDSDDDEEEEGDDESDEETAKKIEASNKRGIESSKKTPVPVKKTKFVTPQKTDSKNVVHAATPHPSKQAGKATANNKLQSPKSGGDYSCKPCNRLFKTEDALSSHNKAKHSAK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain