SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g37460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g37460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g37460

Feature Type:gene_model
Chromosome:Gm19
Start:44597284
stop:44597992
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G10020AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to oxidative stress, anaerobic respiration; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 47 Blast hits to 47 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 46; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:3091225-3091674 REVERSE LENGTH=149 SoyBaseE_val: 4.00E-45ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009061GO-bp Annotation by Michelle Graham. GO Biological Process: anaerobic respiration SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1NAI0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1NAI0_SOYBN SoyBaseE_val: 2.00E-92ISS
UniRef100_Q9SR67UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g10020/T22K18_16 n=1 Tax=Arabidopsis thaliana RepID=Q9SR67_ARATH SoyBaseE_val: 2.00E-42ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g37460 not represented in the dataset

Glyma19g37460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g34780 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g190400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g37460.1   sequence type=CDS   gene model=Glyma19g37460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCCCATTGACGACAAACAAGAGACAGTGACGATAAGAACGGTGAGCCACGACGAGGAAGGGAAAAAGAGGGTGGAGAAGACAGAGCTTAGCACTCACAACATCGACACTATAAGGTACGTCGAGAAGAAGCTCATCAACAAGGGTGTCCAGCGACAGGACCGCCACCCCGCCGACGGCATCGGAATCAGCCGGCCACCGCCAAAGTCCGGCCACGGCGGCAAGTTCACGTGGGAGGGCCCTGCTACAGTGGAGAATAGCGAACTCATGGCGGCGCCGGCGGCCATGGACGAGGGAGACCCCAACTATGTGGACTGGGAAGAGAACGGAGAAGAGGCGTCGGAGTTAGTTGTTGGGGAGGTGGAAGTGTCCAAGGTTGCTCAGGAACACGATGGGCTTGCTAGAGTTGACGTTGATCCTCGCTTGCAAGTTAACTAA

>Glyma19g37460.1   sequence type=predicted peptide   gene model=Glyma19g37460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKPIDDKQETVTIRTVSHDEEGKKRVEKTELSTHNIDTIRYVEKKLINKGVQRQDRHPADGIGISRPPPKSGHGGKFTWEGPATVENSELMAAPAAMDEGDPNYVDWEENGEEASELVVGEVEVSKVAQEHDGLARVDVDPRLQVN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo