SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g37380

Feature Type:gene_model
Chromosome:Gm19
Start:44543693
stop:44545886
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g37380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03790AT Annotation by Michelle Graham. TAIR10: homeobox 51 | chr5:1004985-1006373 FORWARD LENGTH=235 SoyBaseE_val: 5.00E-45ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010434GO-bp Annotation by Michelle Graham. GO Biological Process: bract formation SoyBaseN/AISS
GO:0010582GO-bp Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000976GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region sequence-specific DNA binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG0484 KOG Transcription factor PHOX2/ARIX, contains HOX domain JGI ISS
PTHR24326Panther FAMILY NOT NAMED JGI ISS
PTHR24326:SF227Panther JGI ISS
PF00046PFAM Homeobox domain JGI ISS
PF02183PFAM Homeobox associated leucine zipper JGI ISS
UniRef100_B9SRL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox protein, putative n=1 Tax=Ricinus communis RepID=B9SRL6_RICCO SoyBaseE_val: 3.00E-77ISS
UniRef100_UPI000233E169UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E169 related cluster n=1 Tax=unknown RepID=UPI000233E169 SoyBaseE_val: 1.00E-159ISS

Expression Patterns of Glyma19g37380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g37380
ParalogEvidenceComments
Glyma03g34710 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g37380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g189700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g37380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g37380
>Glyma19g37380.2   sequence type=CDS   gene model=Glyma19g37380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGGCATCATGGCACAAAACCATTTGTTCCTCGGCCAGAGACCTTAAGCTTCTTCTACAACTATGACAACAACAACTCATATCCAGGAGTGGAAGTGAAACAAGCGGCATTGATGGAGACAGGAGAAAGGTCGGTTCCGGCAATGGACCGTGGAAACAAAGAGAAGAAGAAGCGGTTAACAAATAACCAGATAGAGTTATTGGAGAGGAGTTTTCAGGAGGAGATAAAGTTGGACCCTGAAAGGAAGATGAAGCTTTCGAGGGAGCTAGGTCTGCAGCCTCGCCAAATCGCTGTTTGGTTCCAAAATAGACGTACAAGGTGGAAGGCCAAGCAGCTTGAGCACTTGTACGATATGCTTAAACACCAATATGATGTCGTCTCCAACGAAAAGCAGAAGCTTCAAGAAGAGGTTATTAAGTTGAAGGCAATGCTAAGTAAACAGCAAGGTTATTGGACGCAAAAATTTGGAGGTTATACAGAAATATCTGGGGAAGAAACAGTAGAAAGCACGTCAGAGGGTCTAAGGGGAAAGAGTAACATTGAGCATGTTGCAGATCAAGGCTACTGTTCTTTCGCTGTGGAGGATTATAACACCACTGTTTCACTGCCTCACTGCCACTGGCCAGTTGTGCCTTATTAG
Predicted protein sequences of Glyma19g37380
>Glyma19g37380.2   sequence type=predicted peptide   gene model=Glyma19g37380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDWHHGTKPFVPRPETLSFFYNYDNNNSYPGVEVKQAALMETGERSVPAMDRGNKEKKKRLTNNQIELLERSFQEEIKLDPERKMKLSRELGLQPRQIAVWFQNRRTRWKAKQLEHLYDMLKHQYDVVSNEKQKLQEEVIKLKAMLSKQQGYWTQKFGGYTEISGEETVESTSEGLRGKSNIEHVADQGYCSFAVEDYNTTVSLPHCHWPVVPY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo