SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g37031

Feature Type:gene_model
Chromosome:Gm19
Start:44294684
stop:44297179
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g37031
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09920AT Annotation by Michelle Graham. TAIR10: phosphatidyl inositol monophosphate 5 kinase | chr3:3040426-3043676 REVERSE LENGTH=815 SoyBaseE_val: 3.00E-80ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006520GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid metabolic process SoyBaseN/AISS
GO:0046488GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016307GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol phosphate kinase activity SoyBaseN/AISS
GO:0016308GO-mf Annotation by Michelle Graham. GO Molecular Function: 1-phosphatidylinositol-4-phosphate 5-kinase activity SoyBaseN/AISS
PTHR23086Panther PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASE JGI ISS
PTHR23086:SF6Panther PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASE JGI ISS
PF01504PFAM Phosphatidylinositol-4-phosphate 5-Kinase JGI ISS
UniRef100_B9S0D1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphatidylinositol-4-phosphate 5-kinase, putative n=1 Tax=Ricinus communis RepID=B9S0D1_RICCO SoyBaseE_val: 1.00E-95ISS
UniRef100_I1JPS3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JPS3_SOYBN SoyBaseE_val: 7.00E-114ISS

Expression Patterns of Glyma19g37031
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g37031 not represented in the dataset
Glyma19g37031 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g37031 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g186400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g37031
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g37031
>Glyma19g37031.1   sequence type=CDS   gene model=Glyma19g37031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTACAGCCTTCTTCTAAGTGTTCACTGTCGAGCTCCCCAGCATCTGCGTTCTCTCGTTTCACACAACCAAAGTAGAAGTGTGGATGGATTAGCAATGCTTGCAGAGGAAGACCCTCTGGAGGATGAAGTATCCTATCCACAAGGCCTTGTTCTAGTTCCTCGAGGAGCAGATGATGACAGTGTTGTTGTTGGCTCACACATGAGGGGTAGCCGGTTGCGAGCTTCATCTGCTGGTGACGAGGAGGTGGATCTACTTCTACCTGGTACAGCAAGACTCCAAATTCAGCTTGGTGTGAACATGCCATCAAGGGCAGAGCAGATTTCAGAAAAACAAGAAAAGCAAATGTTCCATGAGGTGTACGATGTGGTGCTGTACCTTGGTATCATTGACATATTGCAGAACTACAACATGACTAAGAGGATTGAACATGCATATAAATCTCTTCAGTTTGATTCATTGTCTATCTCAGCTGTAGACCCTACGTTCTACTCTCGTCGCTTCCTGGAATTTATTCAGAAGGTGTTTCCACCAAATGCAACGACAGGTTAA
Predicted protein sequences of Glyma19g37031
>Glyma19g37031.1   sequence type=predicted peptide   gene model=Glyma19g37031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDYSLLLSVHCRAPQHLRSLVSHNQSRSVDGLAMLAEEDPLEDEVSYPQGLVLVPRGADDDSVVVGSHMRGSRLRASSAGDEEVDLLLPGTARLQIQLGVNMPSRAEQISEKQEKQMFHEVYDVVLYLGIIDILQNYNMTKRIEHAYKSLQFDSLSISAVDPTFYSRRFLEFIQKVFPPNATTG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo