SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g36850

Feature Type:gene_model
Chromosome:Gm19
Start:44124436
stop:44126482
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g36850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53220AT Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr3:19722032-19722615 FORWARD LENGTH=126 SoyBaseE_val: 4.00E-55ISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
KOG0907 KOG Thioredoxin JGI ISS
PTHR10438Panther THIOREDOXIN-RELATED JGI ISS
PTHR10438:SF10Panther THIOREDOXIN JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_G7L3W2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin-like protein n=1 Tax=Medicago truncatula RepID=G7L3W2_MEDTR SoyBaseE_val: 2.00E-68ISS
UniRef100_I1NAB4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAB4_SOYBN SoyBaseE_val: 3.00E-96ISS

Expression Patterns of Glyma19g36850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g36850
ParalogEvidenceComments
Glyma03g34131 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g36850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g184600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g36850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g36850
>Glyma19g36850.1   sequence type=CDS   gene model=Glyma19g36850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGAAGCAACGAGCAAGATAAGGCAAAGAAAGGGTTAGAAGGCACTGCCATAGATTTACCTACTAACCGCCGTGTCAACCTGAAAAGCGCTACCAGCGACGACGACTTCACCAACATTCTTGCACACATCAAATCCTCCAAAACCCCCGCTGTCATCAAATATGGCGCTCCTTGGTGTCCCGTTTGTATCCAAATTCTCCCAGCATTCTGTAGACTGAGCAATAATTTTCCAAAGCTTACCTTTGTATACACAGACATCGATGAATGCCCAGAAACAACTCAACACATTCGGTACACTCCCACCTTCCAATTTTACCGGAATGGTGAAAAGGTAGATGAGATGTATGGTGCTGGTGGGGAAGAGAGGCTCCATGATCGTCTGTGGTTGCACTCTTAA
Predicted protein sequences of Glyma19g36850
>Glyma19g36850.1   sequence type=predicted peptide   gene model=Glyma19g36850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGSNEQDKAKKGLEGTAIDLPTNRRVNLKSATSDDDFTNILAHIKSSKTPAVIKYGAPWCPVCIQILPAFCRLSNNFPKLTFVYTDIDECPETTQHIRYTPTFQFYRNGEKVDEMYGAGGEERLHDRLWLHS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo