SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g36840

Feature Type:gene_model
Chromosome:Gm19
Start:44124640
stop:44124894
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g36840
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36880AT Annotation by Michelle Graham. TAIR10: methionine adenosyltransferase 3 | chr2:15479721-15480893 REVERSE LENGTH=390 SoyBaseE_val: 4.00E-35ISS
GO:0006556GO-bp Annotation by Michelle Graham. GO Biological Process: S-adenosylmethionine biosynthetic process SoyBaseN/AISS
GO:0006598GO-bp Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004478GO-mf Annotation by Michelle Graham. GO Molecular Function: methionine adenosyltransferase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11964Panther S-ADENOSYLMETHIONINE SYNTHETASE JGI ISS
PF02773PFAM S-adenosylmethionine synthetase, C-terminal domain JGI ISS
UniRef100_I1L8X2UniRef Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine synthase n=1 Tax=Glycine max RepID=I1L8X2_SOYBN SoyBaseE_val: 3.00E-36ISS
UniRef100_UPI000233E009UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E009 related cluster n=1 Tax=unknown RepID=UPI000233E009 SoyBaseE_val: 8.00E-40ISS

Expression Patterns of Glyma19g36840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g36840
ParalogEvidenceComments
Glyma03g34120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g36840 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g184700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g36840
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g36840
>Glyma19g36840.1   sequence type=CDS   gene model=Glyma19g36840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAATTGGAGATTCCAGACAAGGACATCTTGGCTCTGATGAAGGAAAATTTTGACTTCAGGCCAGGAATGATTGCCATCAATCTTGATCTCATGAGAGGAGGCAACTTCAGGTTCCAGAAAACTGCTGCTTATGGACATTTTGGACGTGACGATCCTGATTTCACTTGGGAGACCATCAAGATCCTCAAGCCTAACGCTTGA
Predicted protein sequences of Glyma19g36840
>Glyma19g36840.1   sequence type=predicted peptide   gene model=Glyma19g36840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLEIPDKDILALMKENFDFRPGMIAINLDLMRGGNFRFQKTAAYGHFGRDDPDFTWETIKILKPNA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo