SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g36791

Feature Type:gene_model
Chromosome:Gm19
Start:44042503
stop:44042861
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g36791
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09630AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L4/L1 family | chr3:2953813-2955444 FORWARD LENGTH=405 SoyBaseE_val: 2.00E-24ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR19431Panther 60S RIBOSOMAL PROTEIN L4 JGI ISS
UniRef100_B9SGS2UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L4, putative n=1 Tax=Ricinus communis RepID=B9SGS2_RICCO SoyBaseE_val: 2.00E-25ISS
UniRef100_I1LZ03UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZ03_SOYBN SoyBaseE_val: 6.00E-27ISS

Expression Patterns of Glyma19g36791
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g36791 not represented in the dataset
Glyma19g36791 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g36791 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g184000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g36791
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g36791
>Glyma19g36791.1   sequence type=CDS   gene model=Glyma19g36791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGGCCAAGGAGCCTTTGAAAACACTTGTTTCCTTCACCGTTGCCTCCGTCATTCCTTCCCTCGTCCTCGCCTACGATCAGCGCATTGAGTTTGTCCTAGAGCTCCCCCTTGTTGTTAGTGACTCCGCTGAAGGCGTCGAGAAGACAAAAGAAGCAATCAAAGTTCTCAAACAGATCAGAGCATTCCCGGATGTCGAGAAGGCGAAAGACAGCCACAACATTTGTCTTTACAAGGGAAAAATGCATAATCGCCGCTACATCTCTCACTAG
Predicted protein sequences of Glyma19g36791
>Glyma19g36791.1   sequence type=predicted peptide   gene model=Glyma19g36791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLAKEPLKTLVSFTVASVIPSLVLAYDQRIEFVLELPLVVSDSAEGVEKTKEAIKVLKQIRAFPDVEKAKDSHNICLYKGKMHNRRYISH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo