Report for Sequence Feature Glyma19g36781
Feature Type: gene_model
Chromosome: Gm19
Start: 44035093
stop: 44035641
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g36781
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G28085 AT
Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr2:11968182-11968556 REVERSE LENGTH=124
SoyBase E_val: 6.00E-20 ISS
GO:0009733 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF02519 PFAM
Auxin responsive protein
JGI ISS
UniRef100_B9S0H6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S0H6_RICCO
SoyBase E_val: 5.00E-27 ISS
UniRef100_UPI000233E006 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233E006 related cluster n=1 Tax=unknown RepID=UPI000233E006
SoyBase E_val: 2.00E-84 ISS
Expression Patterns of Glyma19g36781
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g36781
Paralog Evidence Comments
Glyma03g34031 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g36781 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g183900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g36781
Coding sequences of Glyma19g36781
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g36781.1 sequence type=CDS gene model=Glyma19g36781 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTAAAACATGTAGTAGTAGTTGTTCTTGGGGATTGTGGATCGGAGGGTTTGGAGTAGTGGAGCCTATGATGAGGAAACTACAAAGCACTTTCTCACGTCCAAAAGGGGTGAAGCAGGGCCATTTTTTGGTGATTGCAACACAAGGGTGGAAGCCAGAGAGATTCTCTATTGAGTTGGAGTTTTTGGATCACCCTGACTTTGTGAAGTTGTTAAAGCAAGCTGAAGAAGAGTACGGATTCTCTCAGGTAGGAGCACTTGCAATTCCTTGCGAACCAGATGACTTGAAGAGAATCATTACAAGGAAAAAGAATAGGAACAAGGGTATTGCTATTGCCTGTTGGGTTAAAGGGCTTAGAGTTGCATGA
Predicted protein sequences of Glyma19g36781
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g36781.1 sequence type=predicted peptide gene model=Glyma19g36781 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGKTCSSSCSWGLWIGGFGVVEPMMRKLQSTFSRPKGVKQGHFLVIATQGWKPERFSIELEFLDHPDFVKLLKQAEEEYGFSQVGALAIPCEPDDLKRIITRKKNRNKGIAIACWVKGLRVA*