Glyma19g36731 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g36731

Feature Type:	gene_model
Chromosome:	Gm19
Start:	43985657
stop:	43987270
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g36731

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G62870	AT	Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G12380.1); Has 351 Blast hits to 343 proteins in 42 species: Archae - 2; Bacteria - 0; Metazoa - 27; Fungi - 5; Plants - 299; Viruses - 0; Other Eukaryotes - 18 (source: NCBI BLink). \| chr1:23284220-23286508 REVERSE LENGTH=762	SoyBase	E_val: 5.00E-17	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
UniRef100_Q9LQ19	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: F16P17.2 protein n=1 Tax=Arabidopsis thaliana RepID=Q9LQ19_ARATH	SoyBase	E_val: 2.00E-14	ISS
UniRef100_UPI000233F473	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F473 related cluster n=1 Tax=unknown RepID=UPI000233F473	SoyBase	E_val: 9.00E-52	ISS

Expression Patterns of Glyma19g36731

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g36731 not represented in the dataset	Glyma19g36731 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g36731 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g183300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g36731

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g36731

Limit To All Plant Sequences

>Glyma19g36731.1   sequence type=CDS   gene model=Glyma19g36731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACGCTAGCGTGTCGGTGAACTCCCCCTCCGCCGACAAGGGCGCGACGAAGACGGTGTTGAAGTGCTTCGAAGGGCTTCTGATGGTTCGAAACAAAGTGATAAAGGGAAAAGGCGCATGGTACTGGACGTATCTGGAACCTTTGTTGGTTCACAACATCGAAATGGGACTCCCCAAAGCGTTGAAGGAATTTCTCAGCGAATGGGTGTACGAGTCTTGTGCCGCTGTTTCTTTCTCGAGTTAG

Predicted protein sequences of Glyma19g36731

Limit To All Plant Sequences

>Glyma19g36731.1   sequence type=predicted peptide   gene model=Glyma19g36731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNASVSVNSPSADKGATKTVLKCFEGLLMVRNKVIKGKGAWYWTYLEPLLVHNIEMGLPKALKEFLSEWVYESCAAVSFSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain