SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g36590

Feature Type:gene_model
Chromosome:Gm19
Start:43870714
stop:43875051
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37210AT Annotation by Michelle Graham. TAIR10: lysine decarboxylase family protein | chr2:15624253-15626834 REVERSE LENGTH=215 SoyBaseE_val: 1.00E-134ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03641PFAM Possible lysine decarboxylase JGI ISS
UniRef100_I0IUQ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytokinin riboside 5'-monophosphate phosphoribohydrolase-like n=1 Tax=Solanum lycopersicum RepID=I0IUQ2_SOLLC SoyBaseE_val: 7.00E-137ISS
UniRef100_UPI000233F46DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F46D related cluster n=1 Tax=unknown RepID=UPI000233F46D SoyBaseE_val: 2.00E-160ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g33840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g182100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g36590.2   sequence type=CDS   gene model=Glyma19g36590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACACGAAGTGAGATAAGGCATTCAAAGTTCAAGAGGATTTGTGTGTTCTGTGGCAGTAGCCCTGGCAAGAAGAGTAGCTACCAAGATGCTGCCATTCAACTTGGCAATGAATTGGTCTCAAGGAACATCGATCTGGTGTATGGAGGGGGAAGCATTGGTCTAATGGGTTTAGTTTCACAAGCTGTTCATGATGGCGGTCGCCATGTCATTGGAGTTATTCCCAAGACGCTCATGCCTCGAGAGCTGACTGGTGAAACAGTGGGAGAAGTAAAAGCTGTTGCTGATATGCACCAAAGGAAGGCAGAGATGGCCAAGCATTCAGACGCCTTTATTGCCTTACCAGGTGGATATGGGACTCTAGAGGAGCTTCTTGAAGTCATAACCTGGGCACAACTTGGGATTCATGACAAGCCAGTGGGATTAGTAAATGTTGATGGATACTTTAATTCCTTGCTGTCATTTATTGACAAAGCTGTGGAAGAGGGATTTATCAGTCCAAATGCTCGCCACATAATTGTATCAGCACCAACAGCAAAAGAGTTGGTGAAGAAATTGGAGGATTACGTTCCGTGTCATGAGGGTGTTGCTTCCAAGTTGAGTTGGCAGATAGAACAGCAGCTTGCATACCCTCAAGATTATGACATGTCAAGGTAG

>Glyma19g36590.2   sequence type=predicted peptide   gene model=Glyma19g36590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METRSEIRHSKFKRICVFCGSSPGKKSSYQDAAIQLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLVNVDGYFNSLLSFIDKAVEEGFISPNARHIIVSAPTAKELVKKLEDYVPCHEGVASKLSWQIEQQLAYPQDYDMSR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo