SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g36560

Feature Type:gene_model
Chromosome:Gm19
Start:43829259
stop:43830398
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g36560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60680AT Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF584 | chr5:24386247-24386738 FORWARD LENGTH=163 SoyBaseE_val: 1.00E-29ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04520PFAM Protein of unknown function, DUF584 JGI ISS
UniRef100_I1NA92UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NA92_SOYBN SoyBaseE_val: 8.00E-106ISS
UniRef100_Q9FF51UniRef Annotation by Michelle Graham. Most informative UniRef hit: Emb|CAB72159.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FF51_ARATH SoyBaseE_val: 6.00E-27ISS

Expression Patterns of Glyma19g36560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g36560
ParalogEvidenceComments
Glyma03g33820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g36560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g181800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g36560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g36560
>Glyma19g36560.1   sequence type=CDS   gene model=Glyma19g36560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCTAGGAAGGGATTCCTTTCGAAAGTGAGTTCCATGTTTGTATCATCAAGTACCGATTTGGAGCTGAAATCCACAGAGGGTGACTTGGAATTGGATGAAGCTGAAATGTTCAACTGGAACATGTCCAATGACAACAACAAGAACAACACTGTGACAGAGTCGAAGAAGAGACCACGATCTGGTAAGAAGAAAAAGGTGAACCCTGTGGCCTCATCCTCAATGCCAGTGGCTATTCCTGATTGGTCCAAGATTCTGAAGGAGGACTTCAAGGAGCACAAGAAGAGAGAATTTGTTAGCGACCACGATTACGATCGAGTTCCTCCTCATGAGTATCTTGCTAGAACCAGAGAGGCTTCTCACTCAGTGCATGAAGGAAAAGGAAGGACCCTTAAGGGCAGGGACTTGCGCAGTGTAAGAAATTCCATTTGGAAGAAATTGGGGTTTGAAGATTGA
Predicted protein sequences of Glyma19g36560
>Glyma19g36560.1   sequence type=predicted peptide   gene model=Glyma19g36560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRKGFLSKVSSMFVSSSTDLELKSTEGDLELDEAEMFNWNMSNDNNKNNTVTESKKRPRSGKKKKVNPVASSSMPVAIPDWSKILKEDFKEHKKREFVSDHDYDRVPPHEYLARTREASHSVHEGKGRTLKGRDLRSVRNSIWKKLGFED*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo