Report for Sequence Feature Glyma19g36550
Feature Type: gene_model
Chromosome: Gm19
Start: 43820218
stop: 43820958
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g36550
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_C6SVD5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SVD5_SOYBN
SoyBase E_val: 5.00E-35 ISS
Expression Patterns of Glyma19g36550
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Gene model name correspondences to Glyma19g36550 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g181600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g36550
Coding sequences of Glyma19g36550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g36550.1 sequence type=CDS gene model=Glyma19g36550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTTGTGACGTAGGGTATATAAATATCCATCAATCATCCATGCATGAACATTTTGTCGGTGGTACCATCAAGCATATATCTTGGGTCCATAATCGGGGGCTTAATTTTACGTTTGCAGGAATGGTGAAGTGTAGTAAAGTAAATGTTGCAAGATTTTGTCCCATAAACATGTGA
Predicted protein sequences of Glyma19g36550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g36550.1 sequence type=predicted peptide gene model=Glyma19g36550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVCDVGYINIHQSSMHEHFVGGTIKHISWVHNRGLNFTFAGMVKCSKVNVARFCPINM*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
