SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g36450

Feature Type:gene_model
Chromosome:Gm19
Start:43733877
stop:43738267
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g36450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01790AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L13 family protein | chr3:283880-285583 REVERSE LENGTH=205 SoyBaseE_val: 1.00E-108ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3203 KOG Mitochondrial/chloroplast ribosomal protein L13 JGI ISS
PTHR11545Panther RIBOSOMAL PROTEIN L13 JGI ISS
PF00572PFAM Ribosomal protein L13 JGI ISS
UniRef100_C6SWN9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWN9_SOYBN SoyBaseE_val: 5.00E-145ISS
UniRef100_G7JH46UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L13 n=1 Tax=Medicago truncatula RepID=G7JH46_MEDTR SoyBaseE_val: 1.00E-118ISS

Expression Patterns of Glyma19g36450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g36450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g180500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g36450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g36450
>Glyma19g36450.1   sequence type=CDS   gene model=Glyma19g36450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATGGTAACTGCTTTCAACGGCAACATGAAGAAAGCTGCTGCTGGACTTAGACGCATTAATCTTGATGGTCTTCGATGGAGGGTTTTTGACGCAAAGGGCCAGGTTCTTGGGAGGTTAGCATCTCAAATAGCTACTGTAGTTCAAGGAAAGGATAAACCAACTTACACACCTAATCGTGATGATGGGGATATGTGCATTGTTCTTAATGCAAAAGATATTTGTGTGACTGGGAGAAAACTTACAGACAAGGTCTACTACTGGCATACAGGGTATATTGGCCACCTCAAGCAAAGGACTCTAAAGGATCAAATGGCCAAAGACCCTACTGAAGTCATTCGCAAAGCTGTTCTGCGTATGCTGCCTAGAAACAAACTACGTGATGACAGGGATCGAAAATTAAGGATCTTTCCTGGCAGTGAGCACCCTTTTGTTGATCGCCCACTTGAACCGTATGTGATGCCTCCTAGAAGCGTACGGGAAATGAGGCCGCGAGCAAGGCGTGCCATGATTCGAGCACAGAAGAAGGCAGAGCAGCAACAACAGAAGGCTGATGGAATGAAGGGCAAAAATGGTGAAGCACAGGAAGAAAGTGCATGA
Predicted protein sequences of Glyma19g36450
>Glyma19g36450.1   sequence type=predicted peptide   gene model=Glyma19g36450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMVTAFNGNMKKAAAGLRRINLDGLRWRVFDAKGQVLGRLASQIATVVQGKDKPTYTPNRDDGDMCIVLNAKDICVTGRKLTDKVYYWHTGYIGHLKQRTLKDQMAKDPTEVIRKAVLRMLPRNKLRDDRDRKLRIFPGSEHPFVDRPLEPYVMPPRSVREMRPRARRAMIRAQKKAEQQQQKADGMKGKNGEAQEESA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo