Report for Sequence Feature Glyma19g36350
Feature Type: gene_model
Chromosome: Gm19
Start: 43656904
stop: 43658752
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g36350
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G37120 AT
Annotation by Michelle Graham. TAIR10: S1FA-like DNA-binding protein | chr2:15594250-15594815 REVERSE LENGTH=76
SoyBase E_val: 9.00E-15 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
PF04689 PFAM
DNA binding protein S1FA
JGI ISS
UniRef100_B9SGP8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: DNA-binding protein S1FA, putative n=1 Tax=Ricinus communis RepID=B9SGP8_RICCO
SoyBase E_val: 5.00E-30 ISS
UniRef100_C6SX03 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SX03_SOYBN
SoyBase E_val: 1.00E-55 ISS
Expression Patterns of Glyma19g36350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g36350
Paralog Evidence Comments
Glyma03g33640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g36350 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g179700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g36350
Coding sequences of Glyma19g36350
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g36350.1 sequence type=CDS gene model=Glyma19g36350 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCGATGACTTCGACTTCGCAGATAAAGTTCCTCCTTCGTTCGATCGCGTGGGAAATGTGATCAAGGATTCTGGATCCAAAGCGTTCAATCCGGGTTTAATTGTCCTCCTGGTTGTTGGTGGGTTGCTTTTGACATTCCTCATTGGAAATTATGTGCTCTACACATATGCACAGAAGACCCTCCCTCCTAGAAAAAAGAAGCCCGTTTCAAAGAAGAAGATGAAAAAGGAGAGACTAAAGCAAGGTGTCTCTGCACCTGGAGAGTAG
Predicted protein sequences of Glyma19g36350
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g36350.1 sequence type=predicted peptide gene model=Glyma19g36350 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MADDFDFADKVPPSFDRVGNVIKDSGSKAFNPGLIVLLVVGGLLLTFLIGNYVLYTYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE*