SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
|
|
|
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma19g36100 | Wm82.a1.v1.1 | IGC | Correspondences based on a combination of genome sequence coordinate overlap (fjoin) and sequence similarity (ungapped blastn) |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g36110.1 sequence type=CDS gene model=Glyma19g36110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGGTTAATTTTTGAAAAGGGAACATTATCGTTTAGATTCAGAAATCTGATTTGGAATCAAAGCACTCCCTCCTCTCCCCCTCTCTGTCTATCTGGTTTGTATATACATACATATATATAA
>Glyma19g36110.1 sequence type=predicted peptide gene model=Glyma19g36110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MWLIFEKGTLSFRFRNLIWNQSTPSSPPLCLSGLYIHTYI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
