SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g35755

Feature Type:gene_model
Chromosome:Gm19
Start:43252428
stop:43252688
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g35755
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37430AT Annotation by Michelle Graham. TAIR10: C2H2 and C2HC zinc fingers superfamily protein | chr2:15706454-15706990 FORWARD LENGTH=178 SoyBaseE_val: 1.00E-12ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_B2CZY8UniRef Annotation by Michelle Graham. Best UniRef hit: Putative cold-inducible protein n=1 Tax=Camellia sinensis RepID=B2CZY8_CAMSI SoyBaseE_val: 4.00E-15ISS
UniRef100_O22084UniRef Annotation by Michelle Graham. Most informative UniRef hit: ZPT2-12 n=1 Tax=Petunia x hybrida RepID=O22084_PETHY SoyBaseE_val: 5.00E-12ISS

Expression Patterns of Glyma19g35755
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g35755 not represented in the dataset
Glyma19g35755 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g35755
ParalogEvidenceComments
Glyma03g33060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g35755 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g174100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g35755
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g35755
>Glyma19g35755.1   sequence type=CDS   gene model=Glyma19g35755   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGACATAGAGAAAGTGAAGAAGTAAAGAGCATAGTTACTTCAGTTTGTTTGAAAATGCTGTCTCAAGCAGGAGATAGTCCAACCCGAGAAGTATTCGAGTGCAAGACCTGTAACCGCAAATTCACGTCGTTTCAAGCGTTGGGTGGGCACAGGGCTAGCCACAAGAGTCTCTCTGGGTCAGGCACTGGGAGGCCACATGAGAAAACACACAGAAGGGTTTTCATTTTCTTCTATAAACTAGGTTCTTGCATCTAG
Predicted protein sequences of Glyma19g35755
>Glyma19g35755.1   sequence type=predicted peptide   gene model=Glyma19g35755   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRHRESEEVKSIVTSVCLKMLSQAGDSPTREVFECKTCNRKFTSFQALGGHRASHKSLSGSGTGRPHEKTHRRVFIFFYKLGSCI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo