Glyma19g35480 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g35480

Feature Type:	gene_model
Chromosome:	Gm19
Start:	43068593
stop:	43069234
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g35480

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G26594	AT	Annotation by Michelle Graham. TAIR10: response regulator 24 \| chr5:9269282-9270254 FORWARD LENGTH=139	SoyBase	E_val: 3.00E-39	ISS
GO:0000160	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000156	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity	SoyBase	N/A	ISS
PTHR26402	Panther	RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM	JGI		ISS
PTHR26402:SF221	Panther		JGI		ISS
PF00072	PFAM	Response regulator receiver domain	JGI		ISS
UniRef100_B9GR96	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Extra response regulator n=1 Tax=Populus trichocarpa RepID=B9GR96_POPTR	SoyBase	E_val: 1.00E-43	ISS
UniRef100_I1N9Y5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N9Y5_SOYBN	SoyBase	E_val: 6.00E-72	ISS

Proteins Associated with Glyma19g35480

Locus	Gene Symbol	Protein Name
	RR36	Root Specific, Response Regulator Type-C

Expression Patterns of Glyma19g35480

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g35480

Paralog	Evidence	Comments
Glyma03g32730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g35480 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g171400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g35480

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g35480

Limit To All Plant Sequences

>Glyma19g35480.1   sequence type=CDS   gene model=Glyma19g35480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACCTCGTCAGTTAACAGCACTTATTGTTGAGGATGACATGGTGATTCGAATGGTTCATCAAAAGATTCTGAACAGTGTTGGATTGAAAATTCAAGTCGCGGAAAACGGAAAAGAAGCTATAGAAATTCATGGCTCCGGACAAAGTTTTGACCTAATTCTCATGGATAGGGATATGCCCGTGATGAATGGCATTGAGGCCACAAAGACACTTCGATCAATGGGGATTAATAGCATGATTACTGGTGTATCAACACGCTCAGTGGCAGCGCATATACGAGAATTTATGGAAGCAGGACTAGATGACTACGTAGAGAAGCCTTGA

Predicted protein sequences of Glyma19g35480

Limit To All Plant Sequences

>Glyma19g35480.1   sequence type=predicted peptide   gene model=Glyma19g35480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEPRQLTALIVEDDMVIRMVHQKILNSVGLKIQVAENGKEAIEIHGSGQSFDLILMDRDMPVMNGIEATKTLRSMGINSMITGVSTRSVAAHIREFMEAGLDDYVEKP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain