SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g35295

Feature Type:gene_model
Chromosome:Gm19
Start:42847114
stop:42848029
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g35295
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26594AT Annotation by Michelle Graham. TAIR10: response regulator 24 | chr5:9269282-9270254 FORWARD LENGTH=139 SoyBaseE_val: 9.00E-27ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
PTHR26402Panther RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM JGI ISS
PTHR26402:SF221Panther JGI ISS
PF00072PFAM Response regulator receiver domain JGI ISS
UniRef100_G7KYH3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chemotaxis protein cheY-like protein n=1 Tax=Medicago truncatula RepID=G7KYH3_MEDTR SoyBaseE_val: 1.00E-33ISS
UniRef100_UPI000233F44CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F44C related cluster n=1 Tax=unknown RepID=UPI000233F44C SoyBaseE_val: 7.00E-68ISS

Expression Patterns of Glyma19g35295
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g35295 not represented in the dataset
Glyma19g35295 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g35295 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g169700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g35295
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g35295
>Glyma19g35295.1   sequence type=CDS   gene model=Glyma19g35295   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTGGAAAGACGAAAGAGGAATATAAGCACTGAGCTTATGAGAAGGTGCCACGTGTCCGCTGAGTTGCGATTCGCGTTTTCAGATGAGAGAAAATATCTAAAGATAAGGACGTGGATGTTTGAAAGAGTTGGGATAAAAGATGTTACTGCTGCGAAAAATGGCAAAGAAGCCGTGGATCTTCATCGCATTAATGGTCAAAGTTTTGACCTGATTCTCATGGATAAGGACATGCCTATCATGAATGGAATTCAGGCAACAAAGGAACTTCGCTCAACGGGGATCAGTAGCAAGATTATTGGTGTGTCGTCATCAAGCCGTGAAGAGAGTAATGTACAAGAATTTGTTGAAGCGGGGCTAGATGACTACTACATGAAACCCTTGACCGAAGAAATGCTTAGAGAAATTCTTGATAAGATCAAGCCTTGA
Predicted protein sequences of Glyma19g35295
>Glyma19g35295.1   sequence type=predicted peptide   gene model=Glyma19g35295   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LERRKRNISTELMRRCHVSAELRFAFSDERKYLKIRTWMFERVGIKDVTAAKNGKEAVDLHRINGQSFDLILMDKDMPIMNGIQATKELRSTGISSKIIGVSSSSREESNVQEFVEAGLDDYYMKPLTEEMLREILDKIKP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo