SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g35233

Feature Type:gene_model
Chromosome:Gm19
Start:42777682
stop:42778045
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g35233
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G28680AT Annotation by Michelle Graham. TAIR10: L-tyrosine decarboxylase | chr4:14155248-14158546 FORWARD LENGTH=547 SoyBaseE_val: 7.00E-12ISS
GO:0006520GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid metabolic process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:1901695GO-bp Annotation by Michelle Graham. GO Biological Process: tyramine biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004058GO-mf Annotation by Michelle Graham. GO Molecular Function: aromatic-L-amino-acid decarboxylase activity SoyBaseN/AISS
GO:0004837GO-mf Annotation by Michelle Graham. GO Molecular Function: tyrosine decarboxylase activity SoyBaseN/AISS
GO:0016831GO-mf Annotation by Michelle Graham. GO Molecular Function: carboxy-lyase activity SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
UniRef100_G7KYF2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tyrosine decarboxylase n=1 Tax=Medicago truncatula RepID=G7KYF2_MEDTR SoyBaseE_val: 7.00E-20ISS
UniRef100_I1JP86UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JP86_SOYBN SoyBaseE_val: 1.00E-23ISS

Expression Patterns of Glyma19g35233
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g35233 not represented in the dataset
Glyma19g35233 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g35233
ParalogEvidenceComments
Glyma03g32510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g35233 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g169100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g35233
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g35233
>Glyma19g35233.1   sequence type=CDS   gene model=Glyma19g35233   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAATTGCGACAAATTATGCAATAATAACGTTCTCTTTAGTTTGTTTTCAGCGGTAGATAAGCTAAATTCTGAAGATCATGGGAATAAGCTAAATCGAAATGTTTTCATGACTAACACGGTTCTATCAGGGGAATACATTCTACGTTTTGCAGTAGGAGCACCATTGACAGCAAAGAGGCATGTCAATATGGCATGGCAGATTTTGCAAGATAAAGCCACTGCTCTATTTGAGAGTTTATAA
Predicted protein sequences of Glyma19g35233
>Glyma19g35233.1   sequence type=predicted peptide   gene model=Glyma19g35233   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKNCDKLCNNNVLFSLFSAVDKLNSEDHGNKLNRNVFMTNTVLSGEYILRFAVGAPLTAKRHVNMAWQILQDKATALFESL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo