SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g34945

Feature Type:gene_model
Chromosome:Gm19
Start:42534708
stop:42536807
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g34945
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04450AT Annotation by Michelle Graham. TAIR10: ROP-interactive CRIB motif-containing protein 3 | chr1:1209006-1209853 FORWARD LENGTH=220 SoyBaseE_val: 2.00E-18ISS
GO:0007204GO-bp Annotation by Michelle Graham. GO Biological Process: elevation of cytosolic calcium ion concentration SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0017157GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of exocytosis SoyBaseN/AISS
GO:0030834GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of actin filament depolymerization SoyBaseN/AISS
GO:0050848GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of calcium-mediated signaling SoyBaseN/AISS
GO:0050850GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of calcium-mediated signaling SoyBaseN/AISS
GO:0051650GO-bp Annotation by Michelle Graham. GO Biological Process: establishment of vesicle localization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00786PFAM P21-Rho-binding domain JGI ISS
UniRef100_I1LYM9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LYM9_SOYBN SoyBaseE_val: 7.00E-20ISS
UniRef100_I6QKY5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ROP-interactive CRIB motif-containing protein B n=1 Tax=Helianthus annuus RepID=I6QKY5_HELAN SoyBaseE_val: 7.00E-17ISS

Expression Patterns of Glyma19g34945
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g34945 not represented in the dataset
Glyma19g34945 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g34945
ParalogEvidenceComments
Glyma03g32191 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g34945 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g166300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g34945
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g34945
>Glyma19g34945.1   sequence type=CDS   gene model=Glyma19g34945   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCAACAACAACAAGGTGAAGGGCCTCCTTAAAGGCCTAAGATTCATCTCTCAGATATTCGATACTGATGAAAAAGACTCGGAAATTCAGATTAGCAATCCCACAGATGTAAAGCATGTGGCGCATTTAGGTTCTGGTTCCTCTGAAAATGATCCCAGCTGGATGAACGAGTTTGAATCTGTCCCATGGAATTCATCTGCACCCCAAAATCTTAATGGAGACATTCATAGCAAAAGATCCGATAATTCAGTCCAAAGGACCTCTCACGATTCAATGGAAAGAGGTTCAAGGTCAGGGCATAGTCAAAGTGAAGAGAAGGACTCACGTGAGTTTCCGAAATCATCCAAGCGGCAAACGAAATCAATGGGAAACATAAGAGAGTCTCATGCAAAGGAAAAGTCAGACCGGCCAAGGCCACCTAAAAAGTCATCCAAACCTAATTCACACCCAAATGATCCATGCAATGGGGACACAGATTCACTCGAACAACAACAACAAGGGAGTGATTTGTCACCTAAAAAATCTCGCCCCAAGATGTCAAAAGATGGTTCCAATGTTGGTAGTGGCTCATCCAAATCCAGATCAAAACCCCATCATCATCATCATCATCATCATTCTAAGGACTCAAACTCCAATATTAAAGAAGTCCATGCTAGACACAGTTCTAAGTCCAGGACCAAACACGGGTCCTTTGAAGAAGATGCACAAACTAGGAACAAACACGGGTCCTTTGAAGAGGAAGAAGGACAATTTCAAAGACGTTCTACTGAAAATATACTGAAAAGTTACCCAAATTAG
Predicted protein sequences of Glyma19g34945
>Glyma19g34945.1   sequence type=predicted peptide   gene model=Glyma19g34945   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSNNNKVKGLLKGLRFISQIFDTDEKDSEIQISNPTDVKHVAHLGSGSSENDPSWMNEFESVPWNSSAPQNLNGDIHSKRSDNSVQRTSHDSMERGSRSGHSQSEEKDSREFPKSSKRQTKSMGNIRESHAKEKSDRPRPPKKSSKPNSHPNDPCNGDTDSLEQQQQGSDLSPKKSRPKMSKDGSNVGSGSSKSRSKPHHHHHHHHSKDSNSNIKEVHARHSSKSRTKHGSFEEDAQTRNKHGSFEEEEGQFQRRSTENILKSYPN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo