Glyma19g34720 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g34720

Feature Type:	gene_model
Chromosome:	Gm19
Start:	42326295
stop:	42328741
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g34720

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G31200	AT	Annotation by Michelle Graham. TAIR10: actin depolymerizing factor 6 \| chr2:13294171-13294948 FORWARD LENGTH=146	SoyBase	E_val: 2.00E-86	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin binding	SoyBase	N/A	ISS
KOG1735	KOG	Actin depolymerizing factor	JGI		ISS
PTHR11913	Panther	ACTIN DEPOLYMERIZING FACTOR	JGI		ISS
PF00241	PFAM	Cofilin/tropomyosin-type actin-binding protein	JGI		ISS
UniRef100_C6T540	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T540_SOYBN	SoyBase	E_val: 8.00E-105	ISS
UniRef100_D6BR51	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Actin-depolymerizing factor 6 n=1 Tax=Jatropha curcas RepID=D6BR51_9ROSI	SoyBase	E_val: 7.00E-87	ISS

Expression Patterns of Glyma19g34720

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g34720

Paralog	Evidence	Comments
Glyma03g31960	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g34720 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g164400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g34720

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g34720

Limit To All Plant Sequences

>Glyma19g34720.1   sequence type=CDS   gene model=Glyma19g34720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTTCAGAGGCCTCAGCCGGCCAAATGCCTCATCAGGCATGGGTGTTGCTGATCACAGCAAGAACACCTTCATGGAATTGAAGCAGAAGAAGGTTCACCGTTATCTGATCTTTAAGGTTGATGAGAAGAAAAGGGAAGTTGTGGTTGAGAAGACTGGTGACCCGGCTGAGAGCTATGAGGATTTCGCTGCATCTTTGCCTGAGAATGATTGCAGATATGCTGTCTTTGACTATGATTTCGTCACTTCTGAGAACTGTCAAAAGAGCAAAATCTTCTTCATTGCATGGTCCCCTTCAACGTCTCGAATCCGAGCCAAGATGCTCTATGCCACTACTAAAGACAGGTTTAGACGAGAGCTAGATGGTGTCCATTATGAAATTCAGGCTACTGACCCCACAGAAATGGATCTTGAAGTACTGAGAGACCGTGCACATTGA

Predicted protein sequences of Glyma19g34720

Limit To All Plant Sequences

>Glyma19g34720.1   sequence type=predicted peptide   gene model=Glyma19g34720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFRGLSRPNASSGMGVADHSKNTFMELKQKKVHRYLIFKVDEKKREVVVEKTGDPAESYEDFAASLPENDCRYAVFDYDFVTSENCQKSKIFFIAWSPSTSRIRAKMLYATTKDRFRRELDGVHYEIQATDPTEMDLEVLRDRAH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain