SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g34670

Feature Type:gene_model
Chromosome:Gm19
Start:42262310
stop:42262948
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g34670
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23240AT Annotation by Michelle Graham. TAIR10: ethylene response factor 1 | chr3:8295705-8296361 FORWARD LENGTH=218 SoyBaseE_val: 3.00E-52ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_D8VD37UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene response factor 10 n=1 Tax=Actinidia deliciosa RepID=D8VD37_ACTDE SoyBaseE_val: 2.00E-57ISS
UniRef100_UPI000233F2CDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F2CD related cluster n=1 Tax=unknown RepID=UPI000233F2CD SoyBaseE_val: 2.00E-155ISS

Expression Patterns of Glyma19g34670
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g34670 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g163900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g34670
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g34670
>Glyma19g34670.2   sequence type=CDS   gene model=Glyma19g34670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTCCCCTTTCTTTCAGCATGCAGATTGGGGCATGTTGAAGGAGCCTAATTCGGATATTTTGTTTGAATCATTTTCAAGCAAAGGAGTTGATCATGACCCTTTCCATGATTGTCTTTCCTTTGATATGATTGATAACTCAAGGGATCCACAGGAAGAAAGTCATCATCAAGTGATTGAAGAAGCTATGAAAACAAAGAAGAAGTCTTATATTGGGGTAAGAAGAAGGCCATGGGGAAGATTTGCAGCGGAGATCAGAGACACAACAAGGAAGGGTATAAGGGTTTGGCTTGGAACGTTTGATAGTGCTGAGGAAGCTGCATTGGCTTATGACCAGGCTGCATTTTCCATGAGAGGCTCTAGTGCAGTGCTGAATTTTCCGGTCAAAAGGGTCAAAGAGTCTTTACAAGAGATGAACTATTCTGGTTGCAGCCGAGGGTGCTCTCCTGCATTAGAACTCAAAGAGAGGCACAACATAAGAAGAAAATTGTCGTCATCATCAAAGGCTAAGACAAGTAAAAGGAAACAGGACTTGGAGGAATCCAGTGTTGTGGTGCTGGAGGACTTAGGAGCTGATTATCTGGAGGCACTTCTTAGCACATCGGCGGATCAAAGTGCAACAAGCTCTACCTGCTAA
Predicted protein sequences of Glyma19g34670
>Glyma19g34670.2   sequence type=predicted peptide   gene model=Glyma19g34670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSPFFQHADWGMLKEPNSDILFESFSSKGVDHDPFHDCLSFDMIDNSRDPQEESHHQVIEEAMKTKKKSYIGVRRRPWGRFAAEIRDTTRKGIRVWLGTFDSAEEAALAYDQAAFSMRGSSAVLNFPVKRVKESLQEMNYSGCSRGCSPALELKERHNIRRKLSSSSKAKTSKRKQDLEESSVVVLEDLGADYLEALLSTSADQSATSSTC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo