SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g34661

Feature Type:gene_model
Chromosome:Gm19
Start:42255438
stop:42256575
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g34661
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31230AT Annotation by Michelle Graham. TAIR10: ethylene-responsive element binding factor 15 | chr2:13306676-13307407 REVERSE LENGTH=243 SoyBaseE_val: 1.00E-32ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7JJR7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor 1B n=1 Tax=Medicago truncatula RepID=G7JJR7_MEDTR SoyBaseE_val: 1.00E-32ISS
UniRef100_I1N9Q2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N9Q2_SOYBN SoyBaseE_val: 7.00E-87ISS

Expression Patterns of Glyma19g34661
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g34661 not represented in the dataset
Glyma19g34661 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g34661
ParalogEvidenceComments
Glyma03g31920 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g34661 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g163800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g34661
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g34661
>Glyma19g34661.1   sequence type=CDS   gene model=Glyma19g34661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATCATTCACACTGGACTGACAATTCTACGTGAAGAGCGAAGGGCGGCGCGGTTCACCTATTCGTCCAACCTTGGTCTACCATTGAATCAATTACTTCAATTCTTTGAAATTGCGTTATTTGACTCACGTGTGAAAAGCACTTTTATACTACTAAACCTACGAGCATTTAATGAGAACCAGAGGAGTAGAAGAAGGCCATGGGGAAAATTCGTTGCAGAAAAAAGAGACCCCACAAGAAATGGTGTTCGAGTATGGACTGGAGCATTTGACACTGCTGAAGCAGCTGCTTTGGCTTATGACCAAGCAGCTTTCTTGACAAGGGGTGTTTTGGCTACCCTTAACTTTTCAGTGCAAGTGGTGATGGAGTCCCTTCAAAACATGGGTTTCAAGGCATCGAAAAATGACCTCTCACCCTTGTTGGCACTCAAGAGGATGCACGTGATGAGAACGAAATCTAGGGCTAACAGGAGTGGTAGTAAAAAGGTTAAAAGGGCTTGCAGCAACGGGAAATTGGACACTACTACTCAAAATGTGTTGGTGTTGGAGGGTTTAGGTCCTAATTAA
Predicted protein sequences of Glyma19g34661
>Glyma19g34661.1   sequence type=predicted peptide   gene model=Glyma19g34661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIIHTGLTILREERRAARFTYSSNLGLPLNQLLQFFEIALFDSRVKSTFILLNLRAFNENQRSRRRPWGKFVAEKRDPTRNGVRVWTGAFDTAEAAALAYDQAAFLTRGVLATLNFSVQVVMESLQNMGFKASKNDLSPLLALKRMHVMRTKSRANRSGSKKVKRACSNGKLDTTTQNVLVLEGLGPN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo