SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g34300

Feature Type:gene_model
Chromosome:Gm19
Start:41920701
stop:41922353
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g34300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54560AT Annotation by Michelle Graham. TAIR10: histone H2A 11 | chr3:20196532-20197466 FORWARD LENGTH=136 SoyBaseE_val: 3.00E-78ISS
GO:0006338GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin remodeling SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010468GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression SoyBaseN/AISS
GO:0016048GO-bp Annotation by Michelle Graham. GO Biological Process: detection of temperature stimulus SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0044030GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA methylation SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1757 KOG Histone 2A JGI ISS
PTHR23430Panther HISTONE H2A JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_C6T0M3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=C6T0M3_SOYBN SoyBaseE_val: 3.00E-89ISS
UniRef100_UPI000189DA6FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189DA6F related cluster n=1 Tax=unknown RepID=UPI000189DA6F SoyBaseE_val: 1.00E-90ISS

Expression Patterns of Glyma19g34300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g34300
ParalogEvidenceComments
Glyma03g31460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g34300 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g160400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g34300
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g34300
>Glyma19g34300.1   sequence type=CDS   gene model=Glyma19g34300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGGAAAAGGAGGGAAGGGGCTTGTGGCCGGAAAAACCACGGCAGCGAACAAGGACAAAGACAAGGATAAGAAAAGGCCTGTCTCTCGTTCATCCCGTGCTGGGATCCAGTTTCCTGTGGGTCGTATCCATAGGCAGTTGAAGCAAAGGGTGCAAGCAAATGGACGTGTGGGGGCGACTGCTGCTGTGTACTTGGCCTCCATTCTGGAATATCTGACTGCTGAGGTGCTGGAGCTGGCGGGGAATGCTAGCAAAGATCTGAAGGTGAAGAGGATCACACCAAGGCACTTGCAACTCGCTATCAGGGGAGACGAAGAGCTTGACACCCTCATCAAAGGGACCATTGCTGGTGGTGGTGTTATCCCTCACATTCACAAGTCCTTGATCAACAAAGCTGCCAAAGAATGA
Predicted protein sequences of Glyma19g34300
>Glyma19g34300.1   sequence type=predicted peptide   gene model=Glyma19g34300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGKGGKGLVAGKTTAANKDKDKDKKRPVSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKAAKE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo