SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g34280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g34280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g34280

Feature Type:gene_model
Chromosome:Gm19
Start:41900372
stop:41901513
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g34280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G27030AT Annotation by Michelle Graham. TAIR10: calmodulin 5 | chr2:11532069-11534176 FORWARD LENGTH=181 SoyBaseE_val: 2.00E-69ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
KOG0027 KOG Calmodulin and related proteins (EF-Hand superfamily) JGI ISS
PTHR23050Panther CALCIUM BINDING PROTEIN JGI ISS
PF00036PFAM EF hand JGI ISS
UniRef100_B9S4P7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin, putative n=1 Tax=Ricinus communis RepID=B9S4P7_RICCO SoyBaseE_val: 7.00E-77ISS
UniRef100_I1N9L0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N9L0_SOYBN SoyBaseE_val: 5.00E-100ISS

Expression Patterns of Glyma19g34280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g34280 not represented in the dataset
Glyma19g34280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g34280
ParalogEvidenceComments
Glyma03g31430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g34280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g160100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g34280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g34280
>Glyma19g34280.1   sequence type=CDS   gene model=Glyma19g34280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGGAGGACTGACAGATGATCAGATTGCTGAATTCCATGAAGCCTTTAGCCTCATTGACAAGGATTCTGATGGATTCATTACTGTGGATGAATTGACAACCATTATCCGATCATTAGAAGGGAATCCAACGAAAGAAGAAATCCAAAACATGATTAGTGAGGTCGATATTGATGGGAATGGGAGTATAGATTTTGAAGAGTTCTTGAATATTATGGGAAGAAAAATGAAGGAAACTTTAGCTGAAGAGCTGAAAGAAGCATTCAAAGTATTTGATAGAGATCAAAATGGATACATATCCGCCACTGAGCTGAGGCACGTAATGACGAATTTGGGAGAGAGGCTGACAGGTGAAGAGGCAGAACAAATGATTATGGAGGCAGATTTGGATGGGGATGGTCAAGTTAGTTTTGAAGAATTTGCAAGGATTATGATGCTCAAATGA
Predicted protein sequences of Glyma19g34280
>Glyma19g34280.1   sequence type=predicted peptide   gene model=Glyma19g34280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGGLTDDQIAEFHEAFSLIDKDSDGFITVDELTTIIRSLEGNPTKEEIQNMISEVDIDGNGSIDFEEFLNIMGRKMKETLAEELKEAFKVFDRDQNGYISATELRHVMTNLGERLTGEEAEQMIMEADLDGDGQVSFEEFARIMMLK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo