Glyma19g33961 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g33961

Feature Type:	gene_model
Chromosome:	Gm19
Start:	41590682
stop:	41597276
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g33961

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G03150	AT	Annotation by Michelle Graham. TAIR10: Acyl-CoA N-acyltransferases (NAT) superfamily protein \| chr1:756461-758441 FORWARD LENGTH=174	SoyBase	E_val: 1.00E-44	ISS
GO:0001676	GO-bp	Annotation by Michelle Graham. GO Biological Process: long-chain fatty acid metabolic process	SoyBase	N/A	ISS
GO:0002213	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to insect	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0008080	GO-mf	Annotation by Michelle Graham. GO Molecular Function: N-acetyltransferase activity	SoyBase	N/A	ISS
PTHR23091	Panther	N-TERMINAL ACETYLTRANSFERASE	JGI		ISS
PTHR23091:SF5	Panther	N-ACETYLTRANSFERASE 5	JGI		ISS
PF00583	PFAM	Acetyltransferase (GNAT) family	JGI		ISS
UniRef100_C6SZ70	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ70_SOYBN	SoyBase	E_val: 1.00E-43	ISS
UniRef100_Q9SA54	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: F10O3.2 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SA54_ARATH	SoyBase	E_val: 1.00E-42	ISS

Expression Patterns of Glyma19g33961

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g33961 not represented in the dataset	Glyma19g33961 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g33961

Paralog	Evidence	Comments
Glyma03g31120	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g33961 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g157100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g33961

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma19g33961

Limit To All Plant Sequences

>Glyma19g33961.2   sequence type=transcript   gene model=Glyma19g33961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGTGAACGTGGAACACACCTGACACGCGACACCTGATCTGCGAGCGAGGGTTTGTGAAGATGACGACGATTCGCAGGTTTTGCTGCAACGATCTTCTTCGCTTTGCCGCCGTCAATCTCGACCATCTCACCGAAACCTTCAACATCTGATGGTACATGACCTATCTTGCAAGATGGCCCGGCTATTTCCACGTTGCCGAAGGCCCTGGAAATCGAATCATGGGTTACATTATGGGTAAAGTTGAGGGGCAAGGAGAATCTTGGCATGGCCATGTAACTGCGGTGACCGTTGCTCCAGAGTATCGAAGGCAGCAGTTAGCTAAAAAACTTATGAATCTGCTGGAAGACATCAGTGACAATATGTAAGACGTGTATATGTTTGATTTCTTTTAATCTTTCAAGTTTCTAAAACATTTCCTGTCCTCTTTACACAATCTTATTTGATTTTTCTTTTGCCGGTGGTTTTCTGGTGAATCATGTATTCTGTACTATAGGATATGACATCATCATAATTGATATTTCTCTAGTTGGGAACTGCAAGAAATCTATTGGAAATAGATGCATTTAA

Coding sequences of Glyma19g33961

Limit To All Plant Sequences

>Glyma19g33961.1   sequence type=CDS   gene model=Glyma19g33961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCTATCTTGCAAGATGGCCCGGCTATTTCCACGTTGCCGAAGGCCCTGGAAATCGAATCATGGGTTACATTATGGGTAAAGTTGAGGGGCAAGGAGAATCTTGGCATGGCCATGTAACTGCGGTGACCGTTGCTCCAGAGTATCGAAGGCAGCAGTTAGCTAAAAAACTTATGAATCTGCTGGAAGACATCAGTGACAATATCTTGGCTATGTAA

>Glyma19g33961.2   sequence type=CDS   gene model=Glyma19g33961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCTATCTTGCAAGATGGCCCGGCTATTTCCACGTTGCCGAAGGCCCTGGAAATCGAATCATGGGTTACATTATGGGTAAAGTTGAGGGGCAAGGAGAATCTTGGCATGGCCATGTAACTGCGGTGACCGTTGCTCCAGAGTATCGAAGGCAGCAGTTAGCTAAAAAACTTATGAATCTGCTGGAAGACATCAGTGACAATATGTAA

Predicted protein sequences of Glyma19g33961

Limit To All Plant Sequences

>Glyma19g33961.1   sequence type=predicted peptide   gene model=Glyma19g33961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTYLARWPGYFHVAEGPGNRIMGYIMGKVEGQGESWHGHVTAVTVAPEYRRQQLAKKLMNLLEDISDNILAM*

>Glyma19g33961.2   sequence type=predicted peptide   gene model=Glyma19g33961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTYLARWPGYFHVAEGPGNRIMGYIMGKVEGQGESWHGHVTAVTVAPEYRRQQLAKKLMNLLEDISDNM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain