SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g33921

Feature Type:gene_model
Chromosome:Gm19
Start:41535299
stop:41539629
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g33921
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G02780AT Annotation by Michelle Graham. TAIR10: Terpenoid cyclases/Protein prenyltransferases superfamily protein | chr4:1237881-1244766 REVERSE LENGTH=802 SoyBaseE_val: 6.00E-46ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009686GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0009905GO-mf Annotation by Michelle Graham. GO Molecular Function: ent-copalyl diphosphate synthase activity SoyBaseN/AISS
GO:0010333GO-mf Annotation by Michelle Graham. GO Molecular Function: terpene synthase activity SoyBaseN/AISS
GO:0016829GO-mf Annotation by Michelle Graham. GO Molecular Function: lyase activity SoyBaseN/AISS
PF01397PFAM Terpene synthase, N-terminal domain JGI ISS
PF03936PFAM Terpene synthase family, metal binding domain JGI ISS
UniRef100_G7KDR9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ent-copalyl diphosphate synthase n=1 Tax=Medicago truncatula RepID=G7KDR9_MEDTR SoyBaseE_val: 2.00E-71ISS
UniRef100_I1JNU8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JNU8_SOYBN SoyBaseE_val: 2.00E-90ISS

Expression Patterns of Glyma19g33921
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g33921 not represented in the dataset
Glyma19g33921 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g33921
ParalogEvidenceComments
Glyma03g31080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g33921 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g156800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g33921
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g33921
>Glyma19g33921.1   sequence type=CDS   gene model=Glyma19g33921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCATTCTTGTTTTCTCCATCCTCTACAGCTTAATTATGCTCTCATGCAAACTAAGGATGGAAATGCTCACAACTACTTGGAAAAAACAGTCCATAGGTTCAATGGGGGAGGTGTGTTTGAGTACTTTAAGAAAAATGACGAATTCTTTTGCTTTTCTGGGCAATCAAACCAAGCTGTGACAGGAATGCTTAATCTTTATCGAGCATCTCAAGTGCTATTTCAAGGAGAGAAGATTCTTGAGGATGCCAAGAACTACTCTGCCAAATTTTTAACTAAGAAACTGAAGACGAGATTTTACCTTGAACATTATGGTGGAAGCAGTGATATTTGGATTGCCAAGACCCTTCACAGAATGCCCTATGTGAACAGTGGTGTTTATCTCGAGCTTACAAAATTGGATTACAACAACTGTCAAGCAGAGCATTGTGCGGAATGGGAACAAATCCAAAGGTGGTATACTGAAGCAGGACTAGAGGGATTTGGGTTGAGCAAAGAAAGTCTACTATTTGCTTACTTTATAGCAGCAGCCAGCATATTTGAGCCTACACTGAGGTTGAGCATAAATGATGAAGAAACTAAGAGTGCTTTTGTAGATTTGTTCAATAACAGAATCTACGGACGAAACTACTCAAACAAGCAGTTGAACAAGAGAGAGAATGGAATGCACACCAATGTGAAGAATTCATTCCTCACAGTGGCCAAGGGCTTTTACTATGGCGCATATTGTGACCCAGAGACCATAAACTCCCATGTTGAGAAAGTGCTCTTTCAAAAAGTGATGTAA
Predicted protein sequences of Glyma19g33921
>Glyma19g33921.1   sequence type=predicted peptide   gene model=Glyma19g33921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGHSCFLHPLQLNYALMQTKDGNAHNYLEKTVHRFNGGGVFEYFKKNDEFFCFSGQSNQAVTGMLNLYRASQVLFQGEKILEDAKNYSAKFLTKKLKTRFYLEHYGGSSDIWIAKTLHRMPYVNSGVYLELTKLDYNNCQAEHCAEWEQIQRWYTEAGLEGFGLSKESLLFAYFIAAASIFEPTLRLSINDEETKSAFVDLFNNRIYGRNYSNKQLNKRENGMHTNVKNSFLTVAKGFYYGAYCDPETINSHVEKVLFQKVM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo