Report for Sequence Feature Glyma19g33860
Feature Type: gene_model
Chromosome: Gm19
Start: 41491950
stop: 41494753
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g33860
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G63120 AT
Annotation by Michelle Graham. TAIR10: cyclin p1;1 | chr3:23323143-23323893 REVERSE LENGTH=221
SoyBase E_val: 2.00E-62 ISS
GO:0000079 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cyclin-dependent protein kinase activity
SoyBase N/A ISS
GO:0010440 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression
SoyBase N/A ISS
GO:0051726 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0004693 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase activity
SoyBase N/A ISS
GO:0019901 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase binding
SoyBase N/A ISS
KOG1674
KOG
Cyclin
JGI ISS
PTHR15615 Panther
UNCHARACTERIZED
JGI ISS
PF08613 PFAM
Cyclin
JGI ISS
UniRef100_B9S423 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cyclin-dependent protein kinase, putative n=1 Tax=Ricinus communis RepID=B9S423_RICCO
SoyBase E_val: 8.00E-116 ISS
UniRef100_I1N9H5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N9H5_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma19g33860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g33860
Paralog Evidence Comments
Glyma03g31030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g33860 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g156200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g33860
Coding sequences of Glyma19g33860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g33860.1 sequence type=CDS gene model=Glyma19g33860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTACAAGAACAAGAATAAGCACACACACCCGCCACAACGCTATAGTCATCACTTCGAAGAACTTCACAATTTTGTTTTCTTGGATATGGGGAGTCTTGCTCTTGAAACCGAGGATGTAATCTCAGATATATACCTTTCGCTGGGGCTTAAGGAATCAGACAAAGGAGTAGGAGGTCCTCGGGTTTTATCACTTCTTTCTTCACTTCTTGAGAGATCAGTTCAGAGAAACGAAACATCATTGGAGGCAAAGCACATAAAAGATGTTGTTACAGTATTTCACGGTTTAAGAGCTCCTACTCTGAGTGTTCGAAAGTACATTGATCGTATCTTCAAGTACTCAGGTTGCAGCCCATCATGCTTTGTTGTGGCACACATATATGTGGATAGATTTATTCAGCACACAGAAATCAAATTGACTTCACTTAATGTGCACCGGCTTCTGATAACAAGCATCATGCTAGCAGCAAAGTTTATAGATGACGCATTCTACAACAATGCTTACTATGCAAAAGTTGGAGGAGTGAGCACATCTGAATTAAACAGGTTCGAGATGAGCTTTCTATTTGGCATAGATTTTAGACTTCAGGTTGGTGTAGAAACGTTTGGAAGATATTGTAGGCAATTGGAGAAGGAAGCTGCAGAAGTAGTCCAAATTGAAAGACCAATGCAGGCTTGTCGAATTAAAGAAAGTTGGTCAAACAAAGATGATCCTACTTGTGCTTCCACAATTGCAAGATGA
Predicted protein sequences of Glyma19g33860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g33860.1 sequence type=predicted peptide gene model=Glyma19g33860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MYKNKNKHTHPPQRYSHHFEELHNFVFLDMGSLALETEDVISDIYLSLGLKESDKGVGGPRVLSLLSSLLERSVQRNETSLEAKHIKDVVTVFHGLRAPTLSVRKYIDRIFKYSGCSPSCFVVAHIYVDRFIQHTEIKLTSLNVHRLLITSIMLAAKFIDDAFYNNAYYAKVGGVSTSELNRFEMSFLFGIDFRLQVGVETFGRYCRQLEKEAAEVVQIERPMQACRIKESWSNKDDPTCASTIAR*