Glyma19g33860 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g33860

Feature Type:	gene_model
Chromosome:	Gm19
Start:	41491950
stop:	41494753
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g33860

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G63120	AT	Annotation by Michelle Graham. TAIR10: cyclin p1;1 \| chr3:23323143-23323893 REVERSE LENGTH=221	SoyBase	E_val: 2.00E-62	ISS
GO:0000079	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cyclin-dependent protein kinase activity	SoyBase	N/A	ISS
GO:0010440	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression	SoyBase	N/A	ISS
GO:0051726	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004693	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase activity	SoyBase	N/A	ISS
GO:0019901	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase binding	SoyBase	N/A	ISS
KOG1674	KOG	Cyclin	JGI		ISS
PTHR15615	Panther	UNCHARACTERIZED	JGI		ISS
PF08613	PFAM	Cyclin	JGI		ISS
UniRef100_B9S423	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cyclin-dependent protein kinase, putative n=1 Tax=Ricinus communis RepID=B9S423_RICCO	SoyBase	E_val: 8.00E-116	ISS
UniRef100_I1N9H5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N9H5_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g33860

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g33860

Paralog	Evidence	Comments
Glyma03g31030	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g33860 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g156200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g33860

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g33860

Limit To All Plant Sequences

>Glyma19g33860.1   sequence type=CDS   gene model=Glyma19g33860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACAAGAACAAGAATAAGCACACACACCCGCCACAACGCTATAGTCATCACTTCGAAGAACTTCACAATTTTGTTTTCTTGGATATGGGGAGTCTTGCTCTTGAAACCGAGGATGTAATCTCAGATATATACCTTTCGCTGGGGCTTAAGGAATCAGACAAAGGAGTAGGAGGTCCTCGGGTTTTATCACTTCTTTCTTCACTTCTTGAGAGATCAGTTCAGAGAAACGAAACATCATTGGAGGCAAAGCACATAAAAGATGTTGTTACAGTATTTCACGGTTTAAGAGCTCCTACTCTGAGTGTTCGAAAGTACATTGATCGTATCTTCAAGTACTCAGGTTGCAGCCCATCATGCTTTGTTGTGGCACACATATATGTGGATAGATTTATTCAGCACACAGAAATCAAATTGACTTCACTTAATGTGCACCGGCTTCTGATAACAAGCATCATGCTAGCAGCAAAGTTTATAGATGACGCATTCTACAACAATGCTTACTATGCAAAAGTTGGAGGAGTGAGCACATCTGAATTAAACAGGTTCGAGATGAGCTTTCTATTTGGCATAGATTTTAGACTTCAGGTTGGTGTAGAAACGTTTGGAAGATATTGTAGGCAATTGGAGAAGGAAGCTGCAGAAGTAGTCCAAATTGAAAGACCAATGCAGGCTTGTCGAATTAAAGAAAGTTGGTCAAACAAAGATGATCCTACTTGTGCTTCCACAATTGCAAGATGA

Predicted protein sequences of Glyma19g33860

Limit To All Plant Sequences

>Glyma19g33860.1   sequence type=predicted peptide   gene model=Glyma19g33860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYKNKNKHTHPPQRYSHHFEELHNFVFLDMGSLALETEDVISDIYLSLGLKESDKGVGGPRVLSLLSSLLERSVQRNETSLEAKHIKDVVTVFHGLRAPTLSVRKYIDRIFKYSGCSPSCFVVAHIYVDRFIQHTEIKLTSLNVHRLLITSIMLAAKFIDDAFYNNAYYAKVGGVSTSELNRFEMSFLFGIDFRLQVGVETFGRYCRQLEKEAAEVVQIERPMQACRIKESWSNKDDPTCASTIAR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain