Report for Sequence Feature Glyma19g33670
Feature Type: gene_model
Chromosome: Gm19
Start: 41272889
stop: 41273356
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g33670
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G63095 AT
Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr3:23315506-23316258 FORWARD LENGTH=250
SoyBase E_val: 2.00E-16 ISS
UniRef100_G8A041 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AAA ATPase containing von Willebrand factor type A n=1 Tax=Medicago truncatula RepID=G8A041_MEDTR
SoyBase E_val: 1.00E-37 ISS
UniRef100_I1N9F7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N9F7_SOYBN
SoyBase E_val: 2.00E-95 ISS
Expression Patterns of Glyma19g33670
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g33670
Paralog Evidence Comments
Glyma03g30840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g33670 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g154300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g33670
Coding sequences of Glyma19g33670
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g33670.2 sequence type=CDS gene model=Glyma19g33670 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGATTTTCAACTTAATAACATTGGCTATGACAATATTCCTAGCATTAGTGCCAAAGATGGAGAGTCATATAAGGACACCAGGTATGCCTATGCCGAAAACCCCTCGTCCACTTTGTGCATCACAATTTGCACTAGTGAACTATGCCTGTTCGAGGTTGCCATTCTCCCTCGGTGTTCCACCCGATTCCCCGTCCACTCCTCCGTCCCCCAATGACGAAGAGGGCCACAGAAACAACCACCACAATGGCAGCCACAGACATGGCCATAGACATGGACACAAACATAGGAACCACCAGACAGCTGATGAAGATAATTGTTGCCGGTGGGCTAAGGAAGTTGACAACCAATGTGTGTGTGAACTTCTACTCCGCCTGCCACCCTTCCTTATTAGACCTCTGCATCAGTACACACTTAACGTTGGAGAATCGTGTGATATCACTTACTCATGCGGTGCACCAATATGA
Predicted protein sequences of Glyma19g33670
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g33670.2 sequence type=predicted peptide gene model=Glyma19g33670 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEIFNLITLAMTIFLALVPKMESHIRTPGMPMPKTPRPLCASQFALVNYACSRLPFSLGVPPDSPSTPPSPNDEEGHRNNHHNGSHRHGHRHGHKHRNHQTADEDNCCRWAKEVDNQCVCELLLRLPPFLIRPLHQYTLNVGESCDITYSCGAPI*