Report for Sequence Feature Glyma19g33330
Feature Type: gene_model
Chromosome: Gm19
Start: 40979379
stop: 40980468
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g33330
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G65870 AT
Annotation by Michelle Graham. TAIR10: Disease resistance-responsive (dirigent-like protein) family protein | chr1:24503624-24504193 FORWARD LENGTH=189
SoyBase E_val: 4.00E-47 ISS
GO:0006952 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response
SoyBase N/A ISS
GO:0009807 GO-bp
Annotation by Michelle Graham. GO Biological Process: lignan biosynthetic process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR21495 Panther
NUCLEOPORIN-RELATED
JGI ISS
PTHR21495:SF11 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF03018 PFAM
Dirigent-like protein
JGI ISS
UniRef100_G7KWC7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Disease resistance response protein n=1 Tax=Medicago truncatula RepID=G7KWC7_MEDTR
SoyBase E_val: 3.00E-70 ISS
UniRef100_I1N9C4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N9C4_SOYBN
SoyBase E_val: 2.00E-154 ISS
Expression Patterns of Glyma19g33330
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma19g33330
Paralog Evidence Comments
Glyma03g30420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g33330 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g151300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g33330
Coding sequences of Glyma19g33330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g33330.1 sequence type=CDS gene model=Glyma19g33330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCAATTTCAAAACTTTCTTCATTTCCCAAACCCTAACCCTAACCCTCCTTTTCTCCACCCTAGTGACTGCCACTTACCACCACAACATCTCTCCAAGTCTTGTACGTTCTCGTGAGAAGCTGACCCACCTTCACTTCTACTTGCATGAAATTTTTACTAGCGAAAAACCCTCGAACATCGTAATCGACCCCCCCAAGGTGGTAGCCAGCTCTCCACTTCCATTTGGGTCGCAAGTGGTGATCGAGGACCCATTAACAATTGGGCCTGATGTGAAGTCCAAAGAAATAGGCAAGGCCCAAGGGTTTTACCTATCCGCAACCCAAAGGCCCGGTTTGGAGTTAGAGATAGTCATGGGGATGGCTTTGACCTTCTTAGAAGGCGAATTCAACGGTAGCAGTTTAAGTGTATTGGGGAGAAACAAAATCTTCAATGAGGTAAGGGAGTTGCCAATTATTGGTGGCACGGGTGAGTTTCGCTTCGCACGTGGCTATATCCTTGCTAGGACTGTCAAGGTCGATTACCATAAAGGGGATGCTACCGTCGAATACAATGCATATGTCTACCATTATTCTTCCACCAGCTCTTCTTCCTCTCCCCACCTTTTTAATCAGGGACTTCATTTATGTCATGGAGACTACTAA
Predicted protein sequences of Glyma19g33330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g33330.1 sequence type=predicted peptide gene model=Glyma19g33330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MANFKTFFISQTLTLTLLFSTLVTATYHHNISPSLVRSREKLTHLHFYLHEIFTSEKPSNIVIDPPKVVASSPLPFGSQVVIEDPLTIGPDVKSKEIGKAQGFYLSATQRPGLELEIVMGMALTFLEGEFNGSSLSVLGRNKIFNEVRELPIIGGTGEFRFARGYILARTVKVDYHKGDATVEYNAYVYHYSSTSSSSSPHLFNQGLHLCHGDY*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
