|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G43990 | AT | Annotation by Michelle Graham. TAIR10: SET-domain containing protein lysine methyltransferase family protein | chr5:17698523-17701733 FORWARD LENGTH=717 | SoyBase | E_val: 2.00E-16 | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS |
| GO:0006270 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication initiation | SoyBase | N/A | ISS |
| GO:0006275 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication | SoyBase | N/A | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0016246 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA interference | SoyBase | N/A | ISS |
| GO:0016570 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone modification | SoyBase | N/A | ISS |
| GO:0031047 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA | SoyBase | N/A | ISS |
| GO:0031048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA | SoyBase | N/A | ISS |
| GO:0034968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone lysine methylation | SoyBase | N/A | ISS |
| GO:0048449 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral organ formation | SoyBase | N/A | ISS |
| GO:0048451 | GO-bp | Annotation by Michelle Graham. GO Biological Process: petal formation | SoyBase | N/A | ISS |
| GO:0048453 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sepal formation | SoyBase | N/A | ISS |
| GO:0051322 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anaphase | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0051726 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0018024 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone-lysine N-methyltransferase activity | SoyBase | N/A | ISS |
| PF10440 | PFAM | WIYLD domain | JGI | ISS | |
| UniRef100_G7I6T4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Histone-lysine N-methyltransferase SUVR4 n=1 Tax=Medicago truncatula RepID=G7I6T4_MEDTR | SoyBase | E_val: 4.00E-15 | ISS |
| UniRef100_I1LBP7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LBP7_SOYBN | SoyBase | E_val: 8.00E-26 | ISS |
|
Glyma19g33021 not represented in the dataset |
Glyma19g33021 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g33021.1 sequence type=CDS gene model=Glyma19g33021 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GCTCCTAATCCAAGAGTCATTAAGGCTTATAATGCTATGAGGTCCATAGGAATTTCTGATGACGAGGTGAAACCGGTTTTCAAAAATTTGTTAGAATTGTATGGTAAAAACTGGGAACTTATTGGGGAAGAGAATAATCGTTCACTTATAGATGCATACTTTGAGTTAAAGGAAGATAAGGTTTGTCCAAACATCTTGTGGTAG
>Glyma19g33021.1 sequence type=predicted peptide gene model=Glyma19g33021 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high APNPRVIKAYNAMRSIGISDDEVKPVFKNLLELYGKNWELIGEENNRSLIDAYFELKEDKVCPNILW*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||