SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g32810

Feature Type:gene_model
Chromosome:Gm19
Start:40523911
stop:40526270
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g32810
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57930AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G42190.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr3:21447250-21447675 REVERSE LENGTH=141 SoyBaseE_val: 1.00E-26ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7KVB6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metal tolerance protein n=1 Tax=Medicago truncatula RepID=G7KVB6_MEDTR SoyBaseE_val: 3.00E-62ISS
UniRef100_UPI000233EB99UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EB99 related cluster n=1 Tax=unknown RepID=UPI000233EB99 SoyBaseE_val: 1.00E-89ISS

Expression Patterns of Glyma19g32810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g32810
ParalogEvidenceComments
Glyma03g29910 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g32810 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g146200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g32810
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g32810
>Glyma19g32810.2   sequence type=CDS   gene model=Glyma19g32810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAGAGGCAGAGGAAAAGGGAAGAAACAATCTGTAATTGCTGAGGATCCTGGAAGTGGTGAAGAGGATAAAGTTCCAGCTTATAGAAGAAGAGGAAGACCGGTGAAGCTACTAACAGATGAAATTGAAGAAGTGGAAGTAACTGAAATAATTGAGAAAGATGAGGAGAATGTGAAAGGCAATGGTTCTACCAATGATTTGAAAACTCAGGCTATCACAGTAAATAAAAGAAAAAGGAAGAGATCTACACAGGTTAAAGAGAAGATAGATCCCTTGAAAGAGGACAATGGCATCCTAGCAAAGCCAGGCCCTGATGATTCAATAAAGTCTACTGGATTCCGACAGAACAGGAGCCGGCGTAAGAACAAGCCTCGTCGTGCTGCTGAAGCCGGGGTAGATTGCAAGTGA
Predicted protein sequences of Glyma19g32810
>Glyma19g32810.2   sequence type=predicted peptide   gene model=Glyma19g32810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGRGKGKKQSVIAEDPGSGEEDKVPAYRRRGRPVKLLTDEIEEVEVTEIIEKDEENVKGNGSTNDLKTQAITVNKRKRKRSTQVKEKIDPLKEDNGILAKPGPDDSIKSTGFRQNRSRRKNKPRRAAEAGVDCK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo