SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g32700

Feature Type:gene_model
Chromosome:Gm19
Start:40406369
stop:40407738
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g32700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06860AT Annotation by Michelle Graham. TAIR10: polygalacturonase inhibiting protein 1 | chr5:2132373-2133434 FORWARD LENGTH=330 SoyBaseE_val: 7.00E-137ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0090353GO-mf Annotation by Michelle Graham. GO Molecular Function: polygalacturonase inhibitor activity SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF918Panther JGI ISS
PF00560PFAM Leucine Rich Repeat JGI ISS
PF08263PFAM Leucine rich repeat N-terminal domain JGI ISS
UniRef100_A2Q4V2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Leucine-rich repeat, plant specific n=1 Tax=Medicago truncatula RepID=A2Q4V2_MEDTR SoyBaseE_val: 5.00E-167ISS
UniRef100_I1N956UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1N956_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma19g32700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g32700 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g145200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g32700
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g32700
>Glyma19g32700.1   sequence type=CDS   gene model=Glyma19g32700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAACCATGTATGGAATATGGTGCTTCATCACGGTCCTGTTGTTCTCCCCAGTGGCGTTTTCGGAACTGTGCAACCCACAGGACAAGAAAGTGCTGCTCCAAATCAAGAAGGACTTCAACAACCCTTACCTGCTAGCCTCCTGGAACCCTAACACCGATTGCTGCAACTGGTACTGCGTCCAGTGCCACCCCGAAACGCACCGCATCAACTCCCTCGTCATATTATCCTCTGTTCCCCAAACCAATTTATCCGGCCCAATACCACCCTCCGTCGGTGACCTACCTTTTCTTGAGACCCTTCAATTCCACAAGCTCCCTAAACTCACCGGCCCAATTCAGCCCACTATAGCCAAGCTCACTAAACTCAAGGAGATCTACATCAGCTGGACCAATGTCTCCGGCCCAGTACCCGATTTCTTGGCCCGGCTCACTAACCTCCAGTTTCTTGACCTTTCCTTTAATAACCTCTCAGGCCCAATCCCCAGCTCACTTTCCCAGCTGTCCAACCTAGTTTCCTTACGCTTGGACCGGAATAGGCTCACGGGCCCAATCCCGGAATCATTCGGGTCCTTCAAGAAGCCTGGCCCGAGCCTGTGGCTATCCCACAACCAGCTTTCCGGGCCCATTCCGGCTTCCTTGGCCAACATAGACCCACAAAGGATAGACTTCTCCAGGAACAAACTCGAAGGCGACGCCTCCGTGCTTTTCGGTCGCAACAAAACGACACAGATAGTTGACGTTTCGAGGAACTCGTTGGCGTTTGATTTATCCAAGGTGGAGTTCCCCACGAGCTTGATATCGTTGGATCTGAATCACAATCAGATCACCGGGAGCATTCCCGTGGGGTTGACCGCAGTGGATTTTTTGCAGGGGTTCAACGTGAGCTATAATCGGTTGTGTGGTGAGATACCGCAGGGTGGGAGATTGCAAAAGTTTGATGTGTATTCGTATTTTCACAACAAGTGTTTATGTGGATCACCCCTTACTAGCTGCAAGTGA
Predicted protein sequences of Glyma19g32700
>Glyma19g32700.1   sequence type=predicted peptide   gene model=Glyma19g32700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTMYGIWCFITVLLFSPVAFSELCNPQDKKVLLQIKKDFNNPYLLASWNPNTDCCNWYCVQCHPETHRINSLVILSSVPQTNLSGPIPPSVGDLPFLETLQFHKLPKLTGPIQPTIAKLTKLKEIYISWTNVSGPVPDFLARLTNLQFLDLSFNNLSGPIPSSLSQLSNLVSLRLDRNRLTGPIPESFGSFKKPGPSLWLSHNQLSGPIPASLANIDPQRIDFSRNKLEGDASVLFGRNKTTQIVDVSRNSLAFDLSKVEFPTSLISLDLNHNQITGSIPVGLTAVDFLQGFNVSYNRLCGEIPQGGRLQKFDVYSYFHNKCLCGSPLTSCK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo