Glyma19g32690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g32690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g32690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g32690

Feature Type:	gene_model
Chromosome:	Gm19
Start:	40404308
stop:	40406154
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g32690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62300	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S10p/S20e family protein \| chr5:25021388-25022235 REVERSE LENGTH=124	SoyBase	E_val: 2.00E-75	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0015935	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0900	KOG	40S ribosomal protein S20	JGI		ISS
PTHR11700	Panther	30S RIBOSOMAL PROTEIN S10 FAMILY MEMBER	JGI		ISS
PF00338	PFAM	Ribosomal protein S10p/S20e	JGI		ISS
UniRef100_A2Q4V6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S20-2 n=1 Tax=Medicago truncatula RepID=A2Q4V6_MEDTR	SoyBase	E_val: 4.00E-78	ISS
UniRef100_C6SY25	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SY25_SOYBN	SoyBase	E_val: 7.00E-84	ISS

Expression Patterns of Glyma19g32690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g32690 not represented in the dataset	Glyma19g32690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g32690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g145100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g32690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g32690

Limit To All Plant Sequences

>Glyma19g32690.1   sequence type=CDS   gene model=Glyma19g32690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACTTACGCTGCGATGAAGCCCACAAAGCCCGGCTTGGAGGAGCCCCAGGAGCAGATCCACAAGATAAGGATCACCCTTTCCTCCAAGCACGTCAAAAACCTCGAGAAGGTTTGTGCGGACTTGGTTCGCGGTGCAAAGGACAAGCGCCTCAGGGTTAAGGGACCTGTCAGGATGCCCACTAAGGTTCTTCTCATCACTACCAGGAAGTCCCCTTGTGGTGAAGGTACCAACACATGGGACAGATTTGAACTTCGTGTGCACAAGAGAGTGATTGACCTCTACAGTTCCCCAGATGTAGTTAAGCAGATTACCTCTATCACGATTGAACCTGGTGTGGAGGTTGAGGTTACCATTGCAGATGCTTGA

Predicted protein sequences of Glyma19g32690

Limit To All Plant Sequences

>Glyma19g32690.1   sequence type=predicted peptide   gene model=Glyma19g32690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATYAAMKPTKPGLEEPQEQIHKIRITLSSKHVKNLEKVCADLVRGAKDKRLRVKGPVRMPTKVLLITTRKSPCGEGTNTWDRFELRVHKRVIDLYSSPDVVKQITSITIEPGVEVEVTIADA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain