SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g32560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g32560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g32560

Feature Type:gene_model
Chromosome:Gm19
Start:40304487
stop:40305180
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G45590AT Annotation by Michelle Graham. TAIR10: splicing endonuclease 1 | chr3:16733062-16733775 FORWARD LENGTH=237 SoyBaseE_val: 6.00E-55ISS
GO:0006388GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0000214GO-cc Annotation by Michelle Graham. GO Cellular Compartment: tRNA-intron endonuclease complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000213GO-mf Annotation by Michelle Graham. GO Molecular Function: tRNA-intron endonuclease activity SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004518GO-mf Annotation by Michelle Graham. GO Molecular Function: nuclease activity SoyBaseN/AISS
KOG4685 KOG tRNA splicing endonuclease SEN2 JGI ISS
PTHR21227Panther TRNA-SPLICING ENDONUCLEASE SUBUNIT SEN2 JGI ISS
PF01974PFAM tRNA intron endonuclease, catalytic C-terminal domain JGI ISS
UniRef100_A2Q3E8UniRef Annotation by Michelle Graham. Most informative UniRef hit: TRNA intron endonuclease, catalytic C-terminal n=1 Tax=Medicago truncatula RepID=A2Q3E8_MEDTR SoyBaseE_val: 3.00E-95ISS
UniRef100_I1N943UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N943_SOYBN SoyBaseE_val: 5.00E-113ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g32560 not represented in the dataset

Glyma19g32560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g143800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g32560.1   sequence type=CDS   gene model=Glyma19g32560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACCAAGATGGAAAGGAAAAGATGCAAAAGCTAAAAAGGATGCAGAAGCTGAAGCGCTCAAGGAACCCATGTCAAAGATGGTATCTCAACTTCAGTCTTCTCTAGTTCAATTTGATACTCGTGGATTTCTCTCTGGCAATCTATGTTATTCCTTGAAATGCCTTAAGATTAATGGCAGTGATACAGGACCCCAAAATGATCAAGAGCTGGGGCATTACATGAAGTCAAAGAAAGAAACATTCCTTTGTTTCTACAAGGCTCATTCCCTCCTGAAAATGAAAAACTGGGTAGTGAGGCCAGGAGCTCAGTATGGTGCAGATTTCGTTGTCCATCGTTATCATCCATCTCGAGTCCATTCTGAGTATGGTGTGCTTGTTTTATCAGATGGAGATGATAAAGATCTAAATGGAAGATTAAGAGTATGGTCCGATGTGCATTGCACAACTCGACTTCTTGGAAGCGTTACAAAAATCTTATTGGTTTTGTATGTCAATAAAAATGATAACAACAATGAGTCTCCATTATGTTTGGCAAACTATACTGTTGAAGAGCGCACAATCACCAGATGA

>Glyma19g32560.1   sequence type=predicted peptide   gene model=Glyma19g32560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPRWKGKDAKAKKDAEAEALKEPMSKMVSQLQSSLVQFDTRGFLSGNLCYSLKCLKINGSDTGPQNDQELGHYMKSKKETFLCFYKAHSLLKMKNWVVRPGAQYGADFVVHRYHPSRVHSEYGVLVLSDGDDKDLNGRLRVWSDVHCTTRLLGSVTKILLVLYVNKNDNNNESPLCLANYTVEERTITR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo