SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g32531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g32531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g32531

Feature Type:gene_model
Chromosome:Gm19
Start:40267116
stop:40268278
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G20990AT Annotation by Michelle Graham. TAIR10: synaptotagmin A | chr2:9014827-9017829 FORWARD LENGTH=579 SoyBaseE_val: 9.00E-20ISS
GO:0001778GO-bp Annotation by Michelle Graham. GO Biological Process: plasma membrane repair SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006897GO-bp Annotation by Michelle Graham. GO Biological Process: endocytosis SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009615GO-bp Annotation by Michelle Graham. GO Biological Process: response to virus SoyBaseN/AISS
GO:0032456GO-bp Annotation by Michelle Graham. GO Biological Process: endocytic recycling SoyBaseN/AISS
GO:0046740GO-bp Annotation by Michelle Graham. GO Biological Process: spread of virus in host, cell to cell SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009898GO-cc Annotation by Michelle Graham. GO Cellular Compartment: internal side of plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR10774Panther CALCIUM-DEPENDENT LIPID-BINDING PROTEIN (CALB RELATED) JGI ISS
PTHR10774:SF2Panther CALCIUM LIPID BINDING PROTEIN JGI ISS
UniRef100_G7I517UniRef Annotation by Michelle Graham. Most informative UniRef hit: Synaptotagmin-1 n=1 Tax=Medicago truncatula RepID=G7I517_MEDTR SoyBaseE_val: 9.00E-33ISS
UniRef100_UPI000233B6D2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B6D2 related cluster n=1 Tax=unknown RepID=UPI000233B6D2 SoyBaseE_val: 1.00E-47ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g32531 not represented in the dataset

Glyma19g32531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g143500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g32531.1   sequence type=CDS   gene model=Glyma19g32531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTTCGTGAGCAGTTTCTTGGGGATTTTTGGTTTTGCCGTTGGAATACCTCTTGGCCTCTTAGTTGGGTTCTTTCTCTTTGTCTACTCAGAAACCAAACATGTCAAGGACCCTGTTGTTAGGCCAATCAGTGAATTAGGCCCAAATGCTCTGCAAGAACTTCTGCCCGAGATTCCTCTCTGGAAGCACGACTCAACCGATATTATATTTGCTGAATACATTGGGAAGTATCAGATCAAAGCGATTGATTTTGATGAGTTAAGCCTTGGTACTCTTCCTCCTAGTGTCTGTGGAAAAATTGGAAGCTTTCCCCCAAAAACACAGAAATATGCACATTTCCGAATGAAGATTGAAGACTACTAG

>Glyma19g32531.1   sequence type=predicted peptide   gene model=Glyma19g32531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFVSSFLGIFGFAVGIPLGLLVGFFLFVYSETKHVKDPVVRPISELGPNALQELLPEIPLWKHDSTDIIFAEYIGKYQIKAIDFDELSLGTLPPSVCGKIGSFPPKTQKYAHFRMKIEDY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo